Baculoviral IAP repeat-containing protein 7
|
UniProt : Q96CA5, UniProt ID: BIRC7_HUMAN, Baculoviral IAP repeat-containing protein 7 Homo sapiens MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLR PLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQD KVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPW EEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSPAEAQRAWWVLEPPGARDVE AQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Baculoviral IAP repeat-containing protein 7 contains a PF00097 domain.
Baculoviral IAP repeat-containing protein 7 contains a PF00653 domain.
Baculoviral IAP repeat-containing protein 7 is proteolytically cut by HtrA2 peptidase (S01.278) cleavage..