Isoform 1 of Baculoviral IAP repeat-containing protein 7
|
Isoform 1 of Baculoviral IAP repeat-containing protein 7 Homo sapiens MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLR PLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQD KVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPW EEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGARDVEAQLRRLQEERTCKVCLDR AVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
Isoform 1 of Baculoviral IAP repeat-containing protein 7 contains a PF00097 domain.
Isoform 1 of Baculoviral IAP repeat-containing protein 7 contains a PF00653 domain.
Isoform 1 of Baculoviral IAP repeat-containing protein 7 is proteolytically cut by HtrA2 peptidase (S01.278) cleavage..