Gag polyprotein (Pr gag)

UniProt : Q88937, UniProt ID: Q88937_9RETR,

Gag polyprotein (Pr gag)

Walleye dermal sarcoma virus

MGNSSSTPPPSALKNSDLFKTMLRTQYSGSVKTRRINQDIKKQYPLWPDQGTCATKHWEQ
AVLIPLDSVSEETAKVLNFLRVKIQARKGETARQMTAHTIKKLIVGTIDKNKQQTEILQK
TDESDEEMDTTNTMLFIARNKRERIAQQQQADLAAQQQVLLLQREQQREQREKDIKKRDE
KKKKLLPDTTQKVEQTDIGEASSSDASAQKPISTDNNPDLKVDGVLTRSQHTTVPSNITI
KKDGTSVQYQHPIRNYPTGEGNLTAQVRNPFRPLELQQLRKDCPALPEGIPQLAEWLTQT
MAIYNCDEADVEQLARVIFPTPVRQIAGVINGHAAANTAAKIQNYVTACRQHYPAVCDWG
TIQAFTYKPPQTAHEYVKHAEIIFKNNSGLEWQHATVPFINMVVQGLPPKVTRSLMSGNP
DWSTKTIPQIIPLMQHYLNLQSRQDAKIKQTPLVLQLAMPAQTMNGNKGYVGSYPTNEPY
YSFQQQQRPAPRAPPGNVPSNTCFFCKQPGHWKADCPNKTRNLRNMGNMGRGGRMGGPPY
RSQPYPAFIQPPQNHQNQYNGRMDRSQLQASAQEWLPGTYPA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Gag polyprotein (Pr gag) contains a PF00098 domain.

Gag polyprotein (Pr gag) is proteolytically cut by walleye dermal sarcoma virus retropepsin (A02.063) cleavage. VLQL-AMPA.

Gag polyprotein (Pr gag) is proteolytically cut by walleye dermal sarcoma virus retropepsin (A02.063) cleavage. ARQM-TAHT.

Gag polyprotein (Pr gag) is proteolytically cut by walleye dermal sarcoma virus retropepsin (A02.063) cleavage. QYQH-PIRN.