T-lymphoma invasion and metastasis-inducing protein 1

UniProt : Q60610, UniProt ID: TIAM1_MOUSE,

T-lymphoma invasion and metastasis-inducing protein 1

Mus musculus

MGNAESQNVDHEFYGEKHASLGRKHTSRSLRLSHKTRRTRHASSGKAIHRNSEVSTRSSS
TPSIPQSLAENGLEPFSQEGALDDFGDPIWVDRVDMGLRPVSYTDSSVTPSVDGSIVLTA
ASVQSMPDSEESRLYGDDATYLAEGGRRQCPYTSNGPTFMETASFKKKRSKSADIWREDS
LEFSLSDLSQEHLTSNEEILGSAEEKDCEEARGMETEASPRQLSTCQRANSLGDLYAQKN
SGVKANGGPRNRFSSYCRNLVSDIPDLAKHKMPPAAAEETPPYSNYNTLPCRKSHCLSEG
ATNPQISLSKSMQGRRAKTTQDVNTGEGSEFADSGIEGATTDTDLLSRRSNATNSSYSPP
TGRAFVGSDSGSSSTGDRARQGVYENFRRELEMSTTNSESLEEAGSAHSDEQSSGTLSSP
GQSDILLTAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYETD
GRSGIDHNSVPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWIT
AIHSACAAAVARHHHKEDTLRLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKKTI
LDQIFVWEQNLEQFQMDLFRFRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSVS
SFHALVAARTGEIGVRRRTQAMSRSASKRRSRFSSLWGLDTTSKKKQGRPTINQVFGEGT
DAVKRSLEGIFDDTVPDGKREKEVVLPSVHQHNPDCDIWVHEYFTPSWFCLPNNQPALTV
VRPGDTARDTLELICKTHQLDHSAHYLRLKFLMENRVQFYIPQPEEDIYELLYKEIEICP
KVTQNIHIEKSDAAADNYGFLLSSVDEDGIRRLYVNSVKETGLASKKGLKAGDEILEINN
RAAGTLNSSMLKDFLSQPSLGLLVRTYPEPEGGVELLENPPHRVDGPVDLGESPLAFLTS
NPGHSLSSEQGSSAETAPEEGEGPDLESSDETDHSSKSTEQVAAFCRSLHEMSPSDSSPS
PQDATSPQLATTRQLSDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQDE
LDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFK
LYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPRQQHSSTLESYLIKPIQRVLKYPLLL
RELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVA
DLSMGDLLLHTSVIWLNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRL
SIYEEWDPFRFRHMIPTEALQVRALPSADAEANAVCEIVHVKSESEGRPERVFHLCCSSP
ESRKDFLKSVHSILRDKHRRQLLKTESLPSAQQYVPFGGKRLCALKGARPAMSRAVSAPS
KSLGRRRRRLARNRFTIDSDAISASSPEKEPQQPAGGGDTDRWVEEQFDLAQYEEQDDIK
ETDILSDDDEFCESLKGASVDRDLQEQLQAASISQRARGRRTLDSHASRMTQLKKQAALS
GINGGLESASEEVIWVRREDFAPSRKLNTEI

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

T-lymphoma invasion and metastasis-inducing protein 1 contains a PF00169 domain.

T-lymphoma invasion and metastasis-inducing protein 1 contains a PF00621 domain.

T-lymphoma invasion and metastasis-inducing protein 1 contains a PF02196 domain.

T-lymphoma invasion and metastasis-inducing protein 1 contains a PF00595 domain.

T-lymphoma invasion and metastasis-inducing protein 1 contains a PF00169 domain.

T-lymphoma invasion and metastasis-inducing protein 1 is proteolytically cut by caspase-3 (C14.003) cleavage. DETD-HSSK.