cAMP-dependent protein kinase catalytic subunit alpha

UniProt : P00517, UniProt ID: KAPCA_BOVIN,

cAMP-dependent protein kinase catalytic subunit alpha

Bos taurus

MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cAMP-dependent protein kinase catalytic subunit alpha contains a PF00069 domain.

cAMP-dependent protein kinase catalytic subunit alpha contains a PF00433 domain.

cAMP-dependent protein kinase catalytic subunit alpha is proteolytically cut by meprin beta subunit (M12.004) cleavage. DYEE-EEIR.