Tumor necrosis factor receptor superfamily member 1A

UniProt : P19438, UniProt ID: TNR1A_HUMAN,

Tumor necrosis factor receptor superfamily member 1A

Homo sapiens

MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCT
KCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD
RDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECV
SCSNCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLSLLFIGLMYRYQRWK
SKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFTPTLGFSPVPSSTFTSSSTYT
PGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQSLDTDDPATLY
AVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLEL
LGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Tumor necrosis factor receptor superfamily member 1A contains a PF00020 domain.

Tumor necrosis factor receptor superfamily member 1A contains a PF00020 domain.

Tumor necrosis factor receptor superfamily member 1A contains a PF00020 domain.

Tumor necrosis factor receptor superfamily member 1A contains a PF00531 domain.

Tumor necrosis factor receptor superfamily member 1A is proteolytically cut by caspase-7 (C14.004) cleavage. GELE-GTTT.

Tumor necrosis factor receptor superfamily member 1A is proteolytically cut by ADAM17 peptidase (M12.217) cleavage..

Tumor necrosis factor receptor superfamily member 1A is proteolytically cut by aminopeptidase PILS (M01.018) cleavage..