Tripeptidyl-peptidase 1

UniProt : O14773, UniProt ID: TPP1_HUMAN,

Tripeptidyl-peptidase 1

Homo sapiens

MGLQACLLGLFALILSGKCSYSPEPDQRRTLPPGWVSLGRADPEEELSLTFALRQQNVER
LSELVQAVSDPSSPQYGKYLTLENVADLVRPSPLTLHTVQKWLLAAGAQKCHSVITQDFL
TCWLSIRQAELLLPGAEFHHYVGGPTETHVVRSPHPYQLPQALAPHVDFVGGLHRFPPTS
SLRQRPEPQVTGTVGLHLGVTPSVIRKRYNLTSQDVGSGTSNNSQACAQFLEQYFHDSDL
AQFMRLFGGNFAHQASVARVVGQQGRGRAGIEASLDVQYLMSAGANISTWVYSSPGRHEG
QEPFLQWLMLLSNESALPHVHTVSYGDDEDSLSSAYIQRVNTELMKAAARGLTLLFASGD
SGAGCWSVSGRHQFRPTFPASSPYVTTVGGTSFQEPFLITNEIVDYISGGGFSNVFPRPS
YQEEAVTKFLSSSPHLPPSSYFNASGRAYPDVAALSDGYWVVSNRVPIPWVSGTSASTPV
FGGILSLINEHRILSGRPPLGFLNPRLYQQHGAGLFDVTRGCHESCLDEEVEGQGFCSGP
GWDPVTGWGTPNFPALLKTLLNP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Tripeptidyl-peptidase 1 contains a PF09286 domain.

Tripeptidyl-peptidase 1 is proteolytically cut by tripeptidyl-peptidase I (S53.003) cleavage. GTVG-LHLG.

Tripeptidyl-peptidase 1 is proteolytically cut by tripeptidyl-peptidase I (S53.003) cleavage. PEPQ-VTGT.

Tripeptidyl-peptidase 1 is proteolytically cut by tripeptidyl-peptidase I (S53.003) cleavage. PTSS-LRQR.

Tripeptidyl-peptidase 1 is proteolytically cut by tripeptidyl-peptidase I (S53.003) cleavage. LTLH-TVQK.