Putative uncharacterized protein

UniProt : P35456, Q545X5, UniProt ID: Q545X5_MOUSE, UPAR_MOUSE,

Putative uncharacterized protein

Mus musculus

MGLPRRLLLLLLLATTCVPASQGLQCMQCESNQSCLVEECALGQDLCRTTVLREWQDDRE
LEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRPRPGARGRAFPQGRYLECA
SCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSLKDEDYTRGCGSLPGCPGTAGF
HSNQTFHFLKCCNYTHCNGGPVLDLQSFPPNGFQCYSCEGNNTLGCSSEEASLINCRGPM
NQCLVATGLDVLGNRSYTVRGCATASWCQGSHVADSFPTHLNVSVSCCHGSGCNSPTGGA
PRPGPAQLSLIASLLLTLGLWGVLLWT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF00021 domain.

Putative uncharacterized protein contains a PF00021 domain.

Putative uncharacterized protein is proteolytically cut by plasmin (S01.233) cleavage. ARGR-AFPQ.

Putative uncharacterized protein is proteolytically cut by u-plasminogen activator (S01.231) cleavage. PGAR-GRAF.

Putative uncharacterized protein is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. RAFP-QGRY.