RNA1 polyprotein

UniProt : P03600, UniProt ID: POL1_CPMV,

RNA1 polyprotein

Cowpea mosaic virus

MGLPEYEADSEALLSQLTIEFTPGMTVSSLLAQVTTNDFHSAIEFFAAEKAVDIEGVHYN
AYMQQIRKNPSLLRISVVAYAFHVSDMVAETMSYDVYEFLYKHYALFISNLVTRTLRFKE
LLLFCKQQFLEKMQASIVWAPELEQYLQVEGDAVAQGVSQLLYKMVTWVPTFVRGAVDWS
VDAILVSFRKHFEKMVQEYVPMAHRVCSWLSQLWDKIVQWISQASETMGWFLDGCRDLMT
WGIATLATCSALSLVEKLLVAMGFLVEPFGLSGIFLRTGVVAAACYNYGTNSKGFAEMMA
LLSLAANCVSTVIVGGFFPGEKDNAQSSPVILLEGLAGQMQNFCETTLVSVGKTCTAVNA
ISTCCGNLKALAGRILGMLRDFIWKTLGFETRFLADASLLFGEDVDGWLKAISDLRDQFI
AKSYCSQDEMMQILVLLEKGRQMRKSGLSKGGISPAIINLILKGINDLEQLNRSCSVQGV
RGVRKMPFTIFFQGKSRTGKSLLMSQVTKDFQDHYGLGGETVYSRNPCDQYWSGYRRQPF
VLMDDFAAVVTEPSAEAQMINLISSAPYPLNMAGLEEKGICFDSQFVFVSTNFLEVSPEA
KVRDDEAFKNRRHVIVQVSNDPAKAYDAANFASNQIYTILAWKDGRYNTVCVIEDYDELV
AYLLTRSQQHAEEQEKNLANMMKSATFESHFKSLVEVLELGSMISAGFDIIRPEKLPSEA
KEKRVLYSIPYNGEYCNALIDDNYNVTCWFGECVGNPEQLSKYSEKMLLGAYEFLLCSES
LNVVIQAHLKEMVCPHHYDKELNFIGKIGETYYHNQMVSNIGSMQKWHRAILFGIGVLLG
KEKEKTWYQVQVANVKQALYDMYTKEIRDWPMPIKVTCGIVLAAIGGSAFWKVFQQLVGS
GNGPVLMGVAAGAFSAEPQSRKPNRFDMQQYRYNNVPLKRRVWADAQMSLDQSSVAIMSK
CRANLVFGGTNLQIVMVPGRRFLACKHFFTHIKTKLRVEIVMDGRRYYHQFDPANIYDIP
DSELVLYSHPSLEDVSHSCWDLFCWDPDKELPSVFGADFLSCKYNKFGGFYEAQYADIKV
RTKKECLTIQSGNYVNKVSRYLEYEAPTIPEDCGSLVIAHIGGKHKIVGVHVAGIQGKIG
CASLLPPLEPIAQAQGAEEYFDFLPAEENVSSGVAMVAGLKQGVYIPLPTKTALVETPSE
WHLDTPCDKVPSILVPTDPRIPAQHEGYDPAKSGVSKYSQPMSALDPELLGEVANDVLEL
WHDCAVDWDDFGEVSLEEALNGCEGVEYMERIPLATSEGFPHILSRNGKEKGKRRFVQGD
DCVVSLIPGTTVAKAYEELEASAHRFVPALVGIECPKDEKLPMRKVFDKPKTRCFTILPM
EYNLVVRRKFLNFVRFIMANRHRLSCQVGINPYSMEWSRLAARMKEKGNDVLCCDYSSFD
GLLSKQVMDVIASMINELCGGEDQLKNARRNLLMACCSRLAICKNTVWRVECGIPSGFPM
TVIVNSIFNEILIRYHYKKLMREQQAPELMVQSFDKLIGLVTYGDDNLISVNAVVTPYFD
GKKLKQSLAQGGVTITDGKDKTSLELPFRRLEECDFLKRTFVQRSSTIWDAPEDKASLWS
QLHYVNCNNCEKEVAYLTNVVNVLRELYMHSPREATEFRRKVLKKVSWITSGDLPTLAQL
QEFYEYQRQQGGADNNDTCDLLTSVDLLGPPLSFEKEAMHGCKVSEEIVTKNLAYYDFKR
KGEDEVVFLFNTLYPQSSLPDGCHSVTWSQGSGRGGLPTQSWMSYNISRKDSNINKIIRT
AVSSKKRVIFCARDNMVPVNIVALLCAVRNKLMPTAVSNATLVKVMENAKAFKFLPEEFN
FAFSDV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

RNA1 polyprotein contains a PF00680 domain.

RNA1 polyprotein contains a PF00910 domain.

RNA1 polyprotein contains a PF00548 domain.

RNA1 polyprotein is proteolytically cut by cowpea mosaic-type comovirus picornain 3C (C03.003) cleavage. ADAQ-MSLD.

RNA1 polyprotein is proteolytically cut by cowpea mosaic-type comovirus picornain 3C (C03.003) cleavage. AEPQ-SRKP.

RNA1 polyprotein is proteolytically cut by cowpea mosaic-type comovirus picornain 3C (C03.003) cleavage. DNAQ-SSPV.

RNA1 polyprotein is proteolytically cut by cowpea mosaic-type comovirus picornain 3C (C03.003) cleavage. AQAQ-GAEE.