Low density lipoprotein receptor-related protein 8, apolipoprotein e receptor

UniProt : B1AMT8, UniProt ID: B1AMT8_HUMAN,

Low density lipoprotein receptor-related protein 8, apolipoprotein e receptor

Homo sapiens

MGLPEPGPLRLLALLLLLLLLLLLQLQHLAAAAADPLLGGQGPAKDCEKDQFQCRNERCI
PSVWRCDEDDDCLDHSDEDDCPKKTCADSDFTCDNGHCIHERWKCDGEEECPDGSDESEA
TCTKQVCPAEKLSCGPTSHKCVPASWRCDGEKDCEGGADEAGCATSLGTCRGDEFQCGDG
TCVLAIKHCNQEQDCPDGSDEAGCLQGLNECLHNNGGCSHICTDLKIGFECTCPAGFQLL
DQKTCGDIDECKDPDACSQICVNYKGYFKCECYPGYEMDLLTKNCKAAAGKSPSLIFTNR
HEVRRIDLVKRNYSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAYMDKASDPKEQE
VLIDEQLHSPEGLAVDWVHKHIYWTDSGNKTISVATVDGGRRRTLFSRNLSEPRAIAVDP
LRGFMYWSDWGDQAKIEKSGLNGVDRQTLVSDNIEWPNGITLDLLSQRLYWVDSKLHQLS
SIDFSGGNRKTLISSTDFLSHPFGIAVFEDKVFWTDLENEAIFSANRLNGLEISILAENL
NNPHDIVIFHELKQPRAPDACELSVQPNGGCEYLCLPAPQISSHSPKYTCACPDTMWLGP
DMKRCYRDANEDSKMGSTVTAAVIGIIVPIVVIALLCMSGYLIWRNWKRKNTKSMNFDNP
VYRKTTEEEDEDELHIGRTAQIGHVYPARVALSLEDDGLP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Low density lipoprotein receptor-related protein 8, apolipoprotein e receptor contains a PF00057 domain.

Low density lipoprotein receptor-related protein 8, apolipoprotein e receptor contains a PF00057 domain.

Low density lipoprotein receptor-related protein 8, apolipoprotein e receptor contains a PF07645 domain.

Low density lipoprotein receptor-related protein 8, apolipoprotein e receptor contains a PF00058 domain.

Low density lipoprotein receptor-related protein 8, apolipoprotein e receptor contains a PF00058 domain.

Low density lipoprotein receptor-related protein 8, apolipoprotein e receptor contains a PF00058 domain.

Low density lipoprotein receptor-related protein 8, apolipoprotein e receptor contains a PF00058 domain.

Low density lipoprotein receptor-related protein 8, apolipoprotein e receptor contains a PF00058 domain.

Low density lipoprotein receptor-related protein 8, apolipoprotein e receptor contains a PF00057 domain.

Low density lipoprotein receptor-related protein 8, apolipoprotein e receptor contains a PF00057 domain.

Low density lipoprotein receptor-related protein 8, apolipoprotein e receptor contains a PF00008 domain.

Low density lipoprotein receptor-related protein 8, apolipoprotein e receptor is proteolytically cut by ADAM10 peptidase (M12.210) cleavage..