Glutamate-cysteine ligase (Glutamate-cysteine ligase, catalytic subunit, isoform CRA_a) (cDNA, FLJ94028, Homo sapiens glutamate-cysteine ligase, catalytic subunit (GCLC),mRNA)

UniProt : P48506, Q14TF0, UniProt ID: GSH1_HUMAN, Q14TF0_HUMAN,

Glutamate-cysteine ligase (Glutamate-cysteine ligase, catalytic subunit, isoform CRA_a) (cDNA, FLJ94028, Homo sapiens glutamate-cysteine ligase, catalytic subunit (GCLC),mRNA)

Homo sapiens

MGLLSQGSPLSWEETKRHADHVRRHGILQFLHIYHAVKDRHKDVLKWGDEVEYMLVSFDH
ENKKVRLVLSGEKVLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTV
EANMRKRRKEATSILEENQALCTITSFPRLGCPGFTLPEVKPNPVEGGASKSLFFPDEAI
NKHPRFSTLTRNIRHRRGEKVVINVPIFKDKNTPSPFIETFTEDDEASRASKPDHIYMDA
MGFGMGNCCLQVTFQACSISEARYLYDQLATICPIVMALSAASPFYRGYVSDIDCRWGVI
SASVDDRTREERGLEPLKNNNYRISKSRYDSIDSYLSKCGEKYNDIDLTIDKEIYEQLLQ
EGIDHLLAQHVAHLFIRDPLTLFEEKIHLDDANESDHFENIQSTNWQTMRFKPPPPNSDI
GWRVEFRPMEVQLTDFENSAYVVFVVLLTRVILSYKLDFLIPLSKVDENMKVAQKRDAVL
QGMFYFRKDICKGGNAVVDGCGKAQNSTELAAEEYTLMSIDTIINGKEGVFPGLIPILNS
YLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYS
LILKCNQIANELCECPELLGSAFRKVKYSGSKTDSSN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Glutamate-cysteine ligase (Glutamate-cysteine ligase, catalytic subunit, isoform CRA_a) (cDNA, FLJ94028, Homo sapiens glutamate-cysteine ligase, catalytic subunit (GCLC),mRNA) contains a PF03074 domain.

Glutamate-cysteine ligase (Glutamate-cysteine ligase, catalytic subunit, isoform CRA_a) (cDNA, FLJ94028, Homo sapiens glutamate-cysteine ligase, catalytic subunit (GCLC),mRNA) is proteolytically cut by caspase-3 (C14.003) cleavage. AVVD-GCGK.