Putative uncharacterized protein

UniProt : Q8BSX6, UniProt ID: Q8BSX6_MOUSE,

Putative uncharacterized protein

Mus musculus

MAARRTHERDPIYKIKGLAKDMLDGVFDDLVEKNVLNGDELLKIGESASFILNKAENLVE
NFLEKTDMAGKIFAGHIANSQEQLSLQFSNDEDDGPQKICTPSSPSESKRKVEDDEMEVN
AGLAHESHLMLTAPHGLQSSEVQDTLKLCPRDQFCKIKTERAKEIYPVMEKEGRTRLALI
ICNKKFDYLFDRDNADTDILNMQELLENLGYSVVLKENLTAQEMETELMQFAGRPEHQSS
DSTFLVFMSHGILEGICGVKHRNKKPDVLHDDTIFKIFNNSNCRSLRNKPKILIMQACRG
RYNGTIWVSTNKGIATADTDEERVLSCKWNNSITKAHVETDFIAFKSSTPHNISWKVGKT
GSLFISKLVDCFKKYCWCYHLEEIFRKVQHSFEVPGELTQMPTIERVSMTRYFYLFPGN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein contains a PF00619 domain.

Putative uncharacterized protein contains a PF00656 domain.

Putative uncharacterized protein is proteolytically cut by calpain-2 (C02.002) cleavage. LMLT-APHG.

Putative uncharacterized protein is proteolytically cut by calpain-2 (C02.002) cleavage. CKIK-TERA.

Putative uncharacterized protein is proteolytically cut by caspase-7 (C14.004) cleavage. DEDD-GPQK.

Putative uncharacterized protein is proteolytically cut by caspase-12 (C14.013) cleavage. VETD-FIAF.