Golgi reassembly stacking protein 1, 65kDa, isoform CRA_c

UniProt : B3KWC8, Q9BQQ3, UniProt ID: B3KWC8_HUMAN, GR65_HUMAN,

Golgi reassembly stacking protein 1, 65kDa, isoform CRA_c

Homo sapiens

MGLGVSAEQPAGGAEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNKENDTLKALLK
ANVEKPVKLEVFNMKTMRVREVEVVPSNMWGGQGLLGASVRFCSFRRASEQVWHVLDVEP
SSPAALAGLRPYTDYVVGSDQILQESEDFFTLIESHEGKPLKLMVYNSKSDSCREVTVTP
NAAWGGEGSLGCGIGYGYLHRIPTQPPSYHKKPPGTPPPSALPLGAPPPDALPPGPTPED
SPSLETGSRQSDYMEALLQAPGSSMEDPLPGPGSPSHSAPDPDGLPHFMETPLQPPPPVQ
RVMDPGFLDVSGISLLDNSNASVWPSLPSSTELTTTAVSTSGPEDICSSSSSHERGGEAT
WSGSEFEVSFLDSPGAQAQADHLPQLTLPDSLTSAASPEDGLSAELLEAQAEEEPASTEG
LDTGTEAEGLDSQAQISTTE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Golgi reassembly stacking protein 1, 65kDa, isoform CRA_c contains a PF04495 domain.

Golgi reassembly stacking protein 1, 65kDa, isoform CRA_c is proteolytically cut by caspase-3 (C14.003) cleavage. SLLD-NSNA.

Golgi reassembly stacking protein 1, 65kDa, isoform CRA_c is proteolytically cut by caspase-3 (C14.003) cleavage. TLPD-SLTS.

Golgi reassembly stacking protein 1, 65kDa, isoform CRA_c is proteolytically cut by caspase-3 (C14.003) cleavage. SFLD-SPGA.