Thrombospondin-1

UniProt : P07996, UniProt ID: TSP1_HUMAN,

Thrombospondin-1

Homo sapiens

MGLAWGLGVLFLMHVCGTNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFR
IEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVV
SNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELD
VPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLL
TLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRK
VTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSTSCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARE
TKACKKDACPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDVTENQI
CNKQDCPIDGCLSNPCFAGVKCTSYPDGSWKCGACPPGYSGNGIQCTDVDECKEVPDACF
NHNGEHRCENTDPGYNCLPCPPRFTGSQPFGQGVEHATANKQVCKPRNPCTDGTHDCNKN
AKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDKDNCRLVPNPDQKDSDGDGRGDACKDDFDHDSVPDIDDICPENVDISETDFRRF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDLKYECRDP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Thrombospondin-1 contains a PF00008 domain.

Thrombospondin-1 contains a PF02412 domain.

Thrombospondin-1 contains a PF02412 domain.

Thrombospondin-1 contains a PF02412 domain.

Thrombospondin-1 contains a PF02412 domain.

Thrombospondin-1 contains a PF02412 domain.

Thrombospondin-1 contains a PF05735 domain.

Thrombospondin-1 contains a PF00090 domain.

Thrombospondin-1 contains a PF00090 domain.

Thrombospondin-1 contains a PF00093 domain.

Thrombospondin-1 contains a PF02412 domain.

Thrombospondin-1 contains a PF02412 domain.

Thrombospondin-1 contains a PF02412 domain.

Thrombospondin-1 contains a PF02412 domain.

Thrombospondin-1 contains a PF02412 domain.

Thrombospondin-1 contains a PF02412 domain.

Thrombospondin-1 contains a PF00090 domain.

Thrombospondin-1 is proteolytically cut by ADAMTS1 peptidase (M12.222) cleavage. LANE-LRRP.

Thrombospondin-1 is proteolytically cut by ADAMTS1 peptidase (M12.222) cleavage. LANE-LRRP.

Thrombospondin-1 is proteolytically cut by cathepsin G (S01.133) cleavage..

Thrombospondin-1 is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage..