Putative uncharacterized protein FLJ11273

UniProt : A4D108, Q9NUM4, UniProt ID: A4D108_HUMAN, T106B_HUMAN,

Putative uncharacterized protein FLJ11273

Homo sapiens

MGKSLSHLPLHSSKEDAYDGVTSENMRNGLVNSEVHNEDGRNGDVSQFPYVEFTGRDSVT
CPTCQGTGRIPRGQENQLVALIPYSDQRLRPRRTKLYVMASVFVCLLLSGLAVFFLFPRS
IDVKYIGVKSAYVSYDVQKRTIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKAR
LNNITIIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLISIKVHNIVLMMQVTVTTTYFGHS
EQISQERYQYVDCGRNTTYQLGQSEYLNVLQPQQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Putative uncharacterized protein FLJ11273 contains a PF07092 domain.

Putative uncharacterized protein FLJ11273 is proteolytically cut by caspase () cleavage. DAYD-GVTS.