PMAP: SubstrateDB : Insulin-like growth factor 1 (Somatomedin C) (Insulin-like growth factor 1 (Somatomedin C), isoform CRA

Insulin-like growth factor 1 (Somatomedin C) (Insulin-like growth factor 1 (Somatomedin C), isoform CRA_d)

UniProt : P01343, Q5U743, UniProt ID: IGF1A_HUMAN, Q5U743_HUMAN,

Insulin-like growth factor 1 (Somatomedin C) (Insulin-like growth factor 1 (Somatomedin C), isoform CRA_d)

Homo sapiens

MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVD
ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS
VRAQRHTDMPKTQKEVHLKNASRGSAGNKNYRM

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range:	-
Cleavage position:
Cleavage residues:

Insulin-like growth factor 1 (Somatomedin C) (Insulin-like growth factor 1 (Somatomedin C), isoform CRA_d) contains a PF00049 domain.

Insulin-like growth factor 1 (Somatomedin C) (Insulin-like growth factor 1 (Somatomedin C), isoform CRA_d) is proteolytically cut by furin (S08.071) cleavage. KSAR-SVRA.

Insulin-like growth factor 1 (Somatomedin C) (Insulin-like growth factor 1 (Somatomedin C), isoform CRA_d) is proteolytically cut by cathepsin B (C01.060) cleavage. KPAK-SARS.

Insulin-like growth factor 1 (Somatomedin C) (Insulin-like growth factor 1 (Somatomedin C), isoform CRA_d) is proteolytically cut by cathepsin B (C01.060) cleavage. LKPA-KSAR.

Insulin-like growth factor 1 (Somatomedin C) (Insulin-like growth factor 1 (Somatomedin C), isoform CRA_d) is proteolytically cut by cathepsin B (C01.060) cleavage. PLKP-AKSA.

Insulin-like growth factor 1 (Somatomedin C) (Insulin-like growth factor 1 (Somatomedin C), isoform CRA_d) is proteolytically cut by cathepsin B (C01.060) cleavage. APLK-PAKS.