cDNA, FLJ92130, Homo sapiens high-mobility group box 2 (HMGB2), mRNA (High-mobility group box 2, isoform CRA_a)

UniProt : B2R4K8, P26583, UniProt ID: B2R4K8_HUMAN, HMGB2_HUMAN,

cDNA, FLJ92130, Homo sapiens high-mobility group box 2 (HMGB2), mRNA (High-mobility group box 2, isoform CRA_a)

Homo sapiens

MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKF
EDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGL
SIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTG
SKKKNEPEDEEEEEEEEDEDEEEEDEDEE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ92130, Homo sapiens high-mobility group box 2 (HMGB2), mRNA (High-mobility group box 2, isoform CRA_a) contains a PF00505 domain.

cDNA, FLJ92130, Homo sapiens high-mobility group box 2 (HMGB2), mRNA (High-mobility group box 2, isoform CRA_a) contains a PF00505 domain.

cDNA, FLJ92130, Homo sapiens high-mobility group box 2 (HMGB2), mRNA (High-mobility group box 2, isoform CRA_a) is proteolytically cut by granzyme A (S01.135) cleavage. DMAK-SDKA.