Elongation factor 1-alpha

UniProt : P68104, Q6IPS9, UniProt ID: EF1A1_HUMAN, Q6IPS9_HUMAN,

Elongation factor 1-alpha

Homo sapiens

MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVL
DKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGV
GEFEAGISKNGQTREHALLAYTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKK
IGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTR
PTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALS
EALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPV
LDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPP
LGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Elongation factor 1-alpha contains a PF00009 domain.

Elongation factor 1-alpha contains a PF03143 domain.

Elongation factor 1-alpha contains a PF03144 domain.

Elongation factor 1-alpha is proteolytically cut by granzyme B, human-type (S01.010) cleavage. KSGD-AAIV.

Elongation factor 1-alpha is proteolytically cut by granzyme B, human-type (S01.010) cleavage. PLQD-VYKI.

Elongation factor 1-alpha is proteolytically cut by granzyme B, human-type (S01.010) cleavage. MCVE-SFSD.