cDNA FLJ44734 fis, clone BRACE3026345, highly similar to Insulin-like growth factor II (Insulin-like growth factor 2 (Somatomedin A), isoform CRA_b)

UniProt : B3KX48, P01344, UniProt ID: B3KX48_HUMAN, IGF2_HUMAN,

cDNA FLJ44734 fis, clone BRACE3026345, highly similar to Insulin-like growth factor II (Insulin-like growth factor 2 (Somatomedin A), isoform CRA_b)

Homo sapiens

MGIPMGKSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVS
RRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWK
QSTQRLRRGLPALLRARRGHVLAKELEAFREAKRHRPLIALPTQDPAHGGAPPEMASNRK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ44734 fis, clone BRACE3026345, highly similar to Insulin-like growth factor II (Insulin-like growth factor 2 (Somatomedin A), isoform CRA_b) contains a PF08365 domain.

cDNA FLJ44734 fis, clone BRACE3026345, highly similar to Insulin-like growth factor II (Insulin-like growth factor 2 (Somatomedin A), isoform CRA_b) contains a PF00049 domain.

cDNA FLJ44734 fis, clone BRACE3026345, highly similar to Insulin-like growth factor II (Insulin-like growth factor 2 (Somatomedin A), isoform CRA_b) is proteolytically cut by omptin (A26.001) cleavage. RVSR-RSRG.