Islet amyloid polypeptide (Islet amyloid polypeptide, isoform CRA_a)

UniProt : P10997, Q0ZD87, UniProt ID: IAPP_HUMAN, Q0ZD87_HUMAN,

Islet amyloid polypeptide (Islet amyloid polypeptide, isoform CRA_a)

Homo sapiens

MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAIL
SSTNVGSNTYGKRNAVEVLKREPLNYLPL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Islet amyloid polypeptide (Islet amyloid polypeptide, isoform CRA_a) contains a PF00214 domain.

Islet amyloid polypeptide (Islet amyloid polypeptide, isoform CRA_a) is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. VEKR-KCNT.

Islet amyloid polypeptide (Islet amyloid polypeptide, isoform CRA_a) is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. VEKR-KCNT.

Islet amyloid polypeptide (Islet amyloid polypeptide, isoform CRA_a) is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. YGKR-NAVE.

Islet amyloid polypeptide (Islet amyloid polypeptide, isoform CRA_a) is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. YGKR-NAVE.

Islet amyloid polypeptide (Islet amyloid polypeptide, isoform CRA_a) is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. YGKR-NAVE.

Islet amyloid polypeptide (Islet amyloid polypeptide, isoform CRA_a) is proteolytically cut by proprotein convertase 1 (S08.072) cleavage. YGKR-NAVE.

Islet amyloid polypeptide (Islet amyloid polypeptide, isoform CRA_a) is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. VEKR-KCNT.

Islet amyloid polypeptide (Islet amyloid polypeptide, isoform CRA_a) is proteolytically cut by proprotein convertase 2 (S08.073) cleavage. VEKR-KCNT.