Isoform 2 of Urokinase plasminogen activator surface receptor

UniProt : Q03405, UniProt ID: Q03405-2,

Isoform 2 of Urokinase plasminogen activator surface receptor

Homo sapiens

MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEEL
ELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISC
GSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNG
FHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGP
MNQCLVATGTHERSLWGSWLPCKSTTALRPPCCEEAQATHV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform 2 of Urokinase plasminogen activator surface receptor contains a PF00021 domain.

Isoform 2 of Urokinase plasminogen activator surface receptor contains a PF00021 domain.

Isoform 2 of Urokinase plasminogen activator surface receptor is proteolytically cut by streptopain (C10.001) cleavage..

Isoform 2 of Urokinase plasminogen activator surface receptor is proteolytically cut by streptopain (C10.001) cleavage..

Isoform 2 of Urokinase plasminogen activator surface receptor is proteolytically cut by cathepsin G (S01.133) cleavage. AVTY-SRSR.

Isoform 2 of Urokinase plasminogen activator surface receptor is proteolytically cut by chymotrypsin () cleavage. AVTY-SRSR.

Isoform 2 of Urokinase plasminogen activator surface receptor is proteolytically cut by neutrophil elastase (S01.131) cleavage. GRAV-TYSR.

Isoform 2 of Urokinase plasminogen activator surface receptor is proteolytically cut by plasmin (S01.233) cleavage. TYSR-SRYL.

Isoform 2 of Urokinase plasminogen activator surface receptor is proteolytically cut by u-plasminogen activator (S01.231) cleavage. TYSR-SRYL.