cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f)

UniProt : A8K409, Q03405, UniProt ID: A8K409_HUMAN, UPAR_HUMAN,

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f)

Homo sapiens

MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEEL
ELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISC
GSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNG
FHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGP
MNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDV
QYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) contains a PF00021 domain.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) contains a PF00021 domain.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by streptopain (C10.001) cleavage..

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by streptopain (C10.001) cleavage..

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. RAVT-YSRS.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by cathepsin G (S01.133) cleavage. AVTY-SRSR.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by chymotrypsin () cleavage. AVTY-SRSR.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by neutrophil elastase (S01.131) cleavage. GRAV-TYSR.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by plasmin (S01.233) cleavage. TYSR-SRYL.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by u-plasminogen activator (S01.231) cleavage. TYSR-SRYL.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by prostase (S01.251) cleavage. AVTY-SRSR.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by prostase (S01.251) cleavage. TYSR-SRYL.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by prostase (S01.251) cleavage. VQYR-SGAA.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by plasmin (S01.233) cleavage. TYSR-SRYL.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by plasmin (S01.233) cleavage. NSGR-AVTY.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by matrix metallopeptidase-19 (M10.021) cleavage. RAVT-YSRS.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by u-plasminogen activator (S01.231) cleavage. TYSR-SRYL.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by u-plasminogen activator (S01.231) cleavage. NSGR-AVTY.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by membrane-type matrix metallopeptidase-6 (M10.024) cleavage. RAVT-YSRS.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. RAVT-YSRS.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage..

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by streptopain (C10.001) cleavage..

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. RAVT-YSRS.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by cathepsin G (S01.133) cleavage. AVTY-SRSR.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by chymotrypsin () cleavage. AVTY-SRSR.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by neutrophil elastase (S01.131) cleavage. GRAV-TYSR.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by plasmin (S01.233) cleavage. TYSR-SRYL.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by u-plasminogen activator (S01.231) cleavage. TYSR-SRYL.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by prostase (S01.251) cleavage. AVTY-SRSR.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by prostase (S01.251) cleavage. TYSR-SRYL.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by prostase (S01.251) cleavage. VQYR-SGAA.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by plasmin (S01.233) cleavage. TYSR-SRYL.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by plasmin (S01.233) cleavage. NSGR-AVTY.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by matrix metallopeptidase-19 (M10.021) cleavage. RAVT-YSRS.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by u-plasminogen activator (S01.231) cleavage. TYSR-SRYL.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by u-plasminogen activator (S01.231) cleavage. NSGR-AVTY.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by membrane-type matrix metallopeptidase-6 (M10.024) cleavage. RAVT-YSRS.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by matrix metallopeptidase-3 (M10.005) cleavage. RAVT-YSRS.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage..

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by u-plasminogen activator (S01.231) cleavage. TYSR-SRYL.

cDNA FLJ76029, highly similar to Homo sapiens plasminogen activator, urokinase receptor (PLAUR), transcript variant 1, mRNA (Plasminogen activator, urokinase receptor, isoform CRA_f) is proteolytically cut by u-plasminogen activator (S01.231) cleavage. NSGR-AVTY.