EGF-like module-containing mucin-like hormone receptor-like 2

UniProt : Q9UHX3, UniProt ID: EMR2_HUMAN,

EGF-like module-containing mucin-like hormone receptor-like 2

Homo sapiens

MGGRVFLVFLAFCVWLTLPGAETQDSRGCARWCPQDSSCVNATACRCNPGFSSFSEIITT
PMETCDDINECATLSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDV
DECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKLKPEDPKLCTDVNECTSGQNPCHSSTHC
LNNVGSYQCRCRPGWQPIPGSPNGPNNTVCEDVDECSSGQHQCDSSTVCFNTVGSYSCRC
RPGWKPRHGIPNNQKDTVCEDMTFSTWTPPPGVHSQTLSRFFDKVQDLGRDYKPGLANNT
IQSILQALDELLEAPGDLETLPRLQQHCVASHLLDGLEDVLRGLSKNLSNGLLNFSYPAG
TELSLEVQKQVDRSVTLRQNQAVMQLDWNQAQKSGDPGPSVVGLVSIPGMGKLLAEAPLV
LEPEKQMLLHETHQGLLQDGSPILLSDVISAFLSNNDTQNLSSPVTFTFSHRSVIPRQKV
LCVFWEHGQNGCGHWATTGCSTIGTRDTSTICRCTHLSSFAVLMAHYDVQEEDPVLTVIT
YMGLSVSLLCLLLAALTFLLCKAIQNTSTSLHLQLSLCLFLAHLLFLVAIDQTGHKVLCS
IIAGTLHYLYLATLTWMLLEALYLFLTARNLTVVNYSSINRFMKKLMFPVGYGVPAVTVA
ISAASRPHLYGTPSRCWLQPEKGFIWGFLGPVCAIFSVNLVLFLVTLWILKNRLSSLNSE
VSTLRNTRMLAFKATAQLFILGCTWCLGILQVGPAARVMAYLFTIINSLQGVFIFLVYCL
LSQQVREQYGKWSKGIRKLKTESEMHTLSSSAKADTSKPSTVN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

EGF-like module-containing mucin-like hormone receptor-like 2 contains a PF00002 domain.

EGF-like module-containing mucin-like hormone receptor-like 2 contains a PF01825 domain.

EGF-like module-containing mucin-like hormone receptor-like 2 contains a PF07645 domain.

EGF-like module-containing mucin-like hormone receptor-like 2 contains a PF07645 domain.

EGF-like module-containing mucin-like hormone receptor-like 2 contains a PF07645 domain.

EGF-like module-containing mucin-like hormone receptor-like 2 contains a PF07645 domain.

EGF-like module-containing mucin-like hormone receptor-like 2 is proteolytically cut by EGF-like module containing mucin-like hormone receptor-like 2 (S63.001) cleavage. CTHL-SSFA.