cDNA FLJ76557, highly similar to Homo sapiens calcitonin-related polypeptide, beta (CALCB), mRNA (Calcitonin-related polypeptide, beta, isoform CRA_a)

UniProt : A8K573, P10092, UniProt ID: A8K573_HUMAN, CALCB_HUMAN,

cDNA FLJ76557, highly similar to Homo sapiens calcitonin-related polypeptide, beta (CALCB), mRNA (Calcitonin-related polypeptide, beta, isoform CRA_a)

Homo sapiens

MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQM
KASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGR
RRRDLQA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ76557, highly similar to Homo sapiens calcitonin-related polypeptide, beta (CALCB), mRNA (Calcitonin-related polypeptide, beta, isoform CRA_a) contains a PF00214 domain.

cDNA FLJ76557, highly similar to Homo sapiens calcitonin-related polypeptide, beta (CALCB), mRNA (Calcitonin-related polypeptide, beta, isoform CRA_a) is proteolytically cut by matrix metallopeptidase-2 (M10.003) cleavage. RLAG-LLSR.