cDNA FLJ75751, highly similar to Homo sapiens eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 1, mRNA (Eukaryotic translation elongation factor 1 beta 2, isoform CRA_a)
UniProt : A8K795, P24534, UniProt ID: A8K795_HUMAN, EF1B_HUMAN, cDNA FLJ75751, highly similar to Homo sapiens eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 1, mRNA (Eukaryotic translation elongation factor 1 beta 2, isoform CRA_a) Homo sapiens MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIK SYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLRE ERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPV GYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks. |
cDNA FLJ75751, highly similar to Homo sapiens eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 1, mRNA (Eukaryotic translation elongation factor 1 beta 2, isoform CRA_a) contains a PF00736 domain.
cDNA FLJ75751, highly similar to Homo sapiens eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 1, mRNA (Eukaryotic translation elongation factor 1 beta 2, isoform CRA_a) is proteolytically cut by caspase () cleavage. DDID-LFGS.