Amyloid beta (A4) protein-binding, family B, member 1 interacting protein

UniProt : B1AYC9, Q8R5A3, UniProt ID: AB1IP_MOUSE, B1AYC9_MOUSE,

Amyloid beta (A4) protein-binding, family B, member 1 interacting protein

Mus musculus

MGESNEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPREEFNYTVGFKDLNESLNALE
DQDLDALMADLVADISEAEQRTIQAQKESSQNQDRFALLRASDGQGTASGGYGASAAAID
VSHHEEALPPPPVEPMLDLLPPPPPPPPPELLSKEEEEAKAKADKIKLALEKLKEAKVKK
LVVKVHMDDSSTKSLMVDERQLARDVLDNLFEKTHCDCNVDWCLYEIYPELQIERVFEDH
ENVVEVLSDWTRDTENKVLFLEKEERYAVFKNPQNFYLDNKGKKENKETNEKMNAKNKEY
LLEESFCGTSIIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFI
QFENVNIYYGIQCKMKYKAPTDHCFVLKHPQIQKESQYIKYLCCDDARTLSQWVMGIRIA
KYGKTLYDNYQRAVARAGLASRWTNLGTVGTPMPAQPSTVSSGLKTGTSQPNGQMPQAIP
SAGPPLQEAQTQIETTKDEKQGLGNHSPGATRENHRPKSSLPPPPPPVRRSSDTCGSPAL
PSKVKGPGTCTFPHPPENFLPPPPPPPPEEDNSGLLPPPPPPPYLEEPPDFVPPPPPPAA
VEDSALPPPPPPPPCLSQEITKSSPLPPKKPLVPPKRQENQGLPGAPGNSEQDFMSDLMK
ALQKKRGNIP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Amyloid beta (A4) protein-binding, family B, member 1 interacting protein contains a PF00169 domain.

Amyloid beta (A4) protein-binding, family B, member 1 interacting protein contains a PF00788 domain.

Amyloid beta (A4) protein-binding, family B, member 1 interacting protein is proteolytically cut by caspase-1 (C14.001) cleavage. LMAD-LVAD.