Cyclic AMP-dependent transcription factor ATF-6 alpha

UniProt : P18850, UniProt ID: ATF6A_HUMAN,

Cyclic AMP-dependent transcription factor ATF-6 alpha

Homo sapiens

MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNL
DFDLDLMPWESDIWDINNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEE
LDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQ
PKPLLLPAAPKTQTNSSVPAKTIIIQTVPTLMPLAKQQPIISLQPAPTKGQTVLLSQPTV
VQLQAPGVLPSAQPVLAVAGGVTQLPNHVVNVVPAPSANSPVNGKLSVTKPVLQSTMRNV
GSDIAVLRRQQRMIKNRESACQSRKKKKEYMLGLEARLKAALSENEQLKKENGTLKRQLD
EVVSENQRLKVPSPKRRVVCVMIVLAFIILNYGPMSMLEQDSRRMNPSVSPANQRRHLLG
FSAKEAQDTSDGIIQKNSYRYDHSVSNDKALMVLTEEPLLYIPPPPCQPLINTTESLRLN
HELRGWVHRHEVERTKSRRMTNNQQKTRILQGALEQGSNSQLMAVQYTETTSSISRNSGS
ELQVYYASPRSYQDFFEAIRRRGDTFYVVSFRRDHLLLPATTHNKTTRPKMSIVLPAINI
NENVINGQDYEVMMQIDCQVMDTRILHIKSSSVPPYLRDQQRNQTNTFFGSPPAATEATH
VVSTIPESLQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Cyclic AMP-dependent transcription factor ATF-6 alpha contains a PF00170 domain.

Cyclic AMP-dependent transcription factor ATF-6 alpha is proteolytically cut by S2P peptidase (M50.001) cleavage. RRVV-CVMI.

Cyclic AMP-dependent transcription factor ATF-6 alpha is proteolytically cut by S2P peptidase (M50.001) cleavage. RKVV-CIMV.

Cyclic AMP-dependent transcription factor ATF-6 alpha is proteolytically cut by S2P peptidase (M50.001) cleavage. RRVV-CVMI.

Cyclic AMP-dependent transcription factor ATF-6 alpha is proteolytically cut by S2P peptidase (M50.001) cleavage. RKVV-CIMV.

Cyclic AMP-dependent transcription factor ATF-6 alpha is proteolytically cut by site-1 peptidase (S08.063) cleavage. RHLL-GFSA.

Cyclic AMP-dependent transcription factor ATF-6 alpha is proteolytically cut by S2P peptidase (M50.001) cleavage. RRVV-CVMI.

Cyclic AMP-dependent transcription factor ATF-6 alpha is proteolytically cut by S2P peptidase (M50.001) cleavage. RKVV-CIMV.

Cyclic AMP-dependent transcription factor ATF-6 alpha is proteolytically cut by site-1 peptidase (S08.063) cleavage. RHLL-GFSA.

Cyclic AMP-dependent transcription factor ATF-6 alpha is proteolytically cut by site-1 peptidase (S08.063) cleavage. RHLL-GFSA.

Cyclic AMP-dependent transcription factor ATF-6 alpha is proteolytically cut by () cleavage..