cDNA FLJ16565 fis, clone SYNOV4007711, highly similar to Homo sapiens zinc finger protein, subfamily 1A, 5 (ZNFN1A5), mRNA

UniProt : B3KVH7, Q9H5V7, UniProt ID: B3KVH7_HUMAN, IKZF5_HUMAN,

cDNA FLJ16565 fis, clone SYNOV4007711, highly similar to Homo sapiens zinc finger protein, subfamily 1A, 5 (ZNFN1A5), mRNA

Homo sapiens

MGEKKPEPLDFVKDFQEYLTQQTHHVNMISGSVSGDKEAEALQGAGTDGDQNGLDHPSVE
VSLDENSGMLVDGFERTFDGKLKCRYCNYASKGTARLIEHIRIHTGEKPHRCHLCPFASA
YERHLEAHMRSHTGEKPYKCELCSFRCSDRSNLSHHRRRKHKMVPIKGTRSSLSSKKMWG
VLQKKTSNLGYSRRALINLSPPSMVVQKPDYLNDFTHEIPNIQTDSYESMAKTTPTGGLP
RDPQELMVDNPLNQLSTLAGQLSSLPPENQNPASPDVVPCPDEKPFMIQQPSTQAVVSAV
SASIPQSSSPTSPEPRPSHSQRNYSPVAGPSSEPSAHTSTPSIGNSQPSTPAPALPVQDP
QLLHHCQHCDMYFADNILYTIHMGCHGYENPFQCNICGCKCKNKYDFACHFARGQHNQH

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ16565 fis, clone SYNOV4007711, highly similar to Homo sapiens zinc finger protein, subfamily 1A, 5 (ZNFN1A5), mRNA contains a PF00096 domain.

cDNA FLJ16565 fis, clone SYNOV4007711, highly similar to Homo sapiens zinc finger protein, subfamily 1A, 5 (ZNFN1A5), mRNA is proteolytically cut by caspase () cleavage. IQTD-SYES.