Gap junction alpha-8 protein

UniProt : P36381, UniProt ID: CXA8_CHICK,

Gap junction alpha-8 protein

Gallus gallus

MGDWSFLGNILEQVNEQSTVIGRVWLTVLFIFRILILGTAAELVWGDEQSDFVCNTQQPG
CENVCYDEAFPISHIRLWVLQIIFVSTPSLVYFGHAVHHVRMEEKRKEREEAERRQQAEV
DEEKLPLAPNQNKGNNPDGTKKFRLEGTLLRTYILHIIFKTLFEVGFIVGQYFLYGFRIL
PLYRCGRWPCPNLVDCFVSRPTEKTIFIMFMLVVAAVSLFLNLVEISHLILKRIRRALRR
PAEEQMGEVPEKPLHAIAVSSIPKAKGYKLLEEEKPVSHYFPLTEVGVEPSPLPSAFNEF
EEKIGMGPLEDLSRAFDERLPSYAQAKEPEEEKVKAEEEEEQEEEQQAPQEEPGVKKAEE
EVVSDEVEGPSAPAELATDVRSLSRLSKASSRARSDDLTV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Gap junction alpha-8 protein contains a PF00029 domain.

Gap junction alpha-8 protein contains a PF03509 domain.

Gap junction alpha-8 protein is proteolytically cut by caspase-3 (C14.003) cleavage. DEVE-GPSA.