DEAH (Asp-Glu-Ala-His) box polypeptide 9 (DEAH (Asp-Glu-Ala-His) box polypeptide 9, isoform CRA_b)

UniProt : B2RNV4, Q08211, UniProt ID: B2RNV4_HUMAN, DHX9_HUMAN,

DEAH (Asp-Glu-Ala-His) box polypeptide 9 (DEAH (Asp-Glu-Ala-His) box polypeptide 9, isoform CRA_b)

Homo sapiens

MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSN
AARDFVNYLVRINEIKSEEVPAFGVASPPPLTDTPDTTANAEGDLPTTMGGPLPPHLALK
AENNSEVGASGYGVPGPTWDRGANLKDYYSRKEEQEVQATLESEEVDLNAGLHGNWTLEN
AKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKQLGRRIFAREHGSNKKLAAQ
SCALSLVRQLYHLGVVEAYSGLTKKKEGETVEPYKVNLSQDLEHQLQNIIQELNLEILPP
PEDPSVPVALNIGKLAQFEPSQRQNQVGVVPWSPPQSNWNPWTSSNIDEGPLAFATPEQI
SMDLKNELMYQLEQDHDLQAILQERELLPVKKFESEILEAISQNSVVIIRGATGCGKTTQ
VPQFILDDFIQNDRAAECNIVVTQPRRISAVSVAERVAFERGEEPGKSCGYSVRFESILP
RPHASIMFCTVGVLLRKLEAGIRGISHVIVDEIHERDINTDFLLVVLRDVVQAYPEVRIV
LMSATIDTSMFCEYFFNCPIIEVYGRTYPVQEYFLEDCIQMTHFVPPPKDKKKKDKDDDG
GEDDDANCNLICGDEYGPETRLSMSQLNEKETPFELIEALLKYIETLNVPGAVLVFLPGW
NLIYTMQKHLEMNPHFGSHRYQILPLHSQIPREEQRKVFDPVPVGVTKVILSTNIAETSI
TINDVVYVIDSCKQKVKLFTAHNNMTNYATVWASKTNLEQRKGRAGRVRPGFCFHLCSRA
RFERLETHMTPEMFRTPLHEIALSIKLLRLGGIGQFLAKAIEPPPLDAVIEAEHTLRELD
ALDANDELTPLGRILAKLPIEPRFGKMMIMGCIFYVGDAICTIAAATCFPEPFINEGKRL
GYIHRNFAGNRFSDHVALLSVFQAWDDARMGGEEAEIRFCEHKRLNMATLRMTWEAKVQL
KEILINSGFPEDCLLTQVFTNTGPDNNLDVVISLLAFGVYPNVCYHKEKRKILTTEGRNA
LIHKSSVNCPFSSQDMKYPSPFFVFGEKIRTRAISAKGMTLVTPLQLLLFASKKVQSDGQ
IVLVDDWIKLQISHEAAACITGLRAAMEALVVEVTKQPAIISQLDPVNERMLNMIRQISR
PSAAGINLMIGSTRYGDGPRPPKMARYDNGSGYRRGGSSYSGGGYGGGYSSGGYGSGGYG
GSANSFRAGYGAGVGGGYRGVSRGGFRGNSGGDYRGPSGGYRGSGGFQRGGGRGAYGTGY
FGQGRGGGGY

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

DEAH (Asp-Glu-Ala-His) box polypeptide 9 (DEAH (Asp-Glu-Ala-His) box polypeptide 9, isoform CRA_b) contains a PF00035 domain.

DEAH (Asp-Glu-Ala-His) box polypeptide 9 (DEAH (Asp-Glu-Ala-His) box polypeptide 9, isoform CRA_b) contains a PF00270 domain.

DEAH (Asp-Glu-Ala-His) box polypeptide 9 (DEAH (Asp-Glu-Ala-His) box polypeptide 9, isoform CRA_b) contains a PF04408 domain.

DEAH (Asp-Glu-Ala-His) box polypeptide 9 (DEAH (Asp-Glu-Ala-His) box polypeptide 9, isoform CRA_b) contains a PF07717 domain.

DEAH (Asp-Glu-Ala-His) box polypeptide 9 (DEAH (Asp-Glu-Ala-His) box polypeptide 9, isoform CRA_b) contains a PF00271 domain.

DEAH (Asp-Glu-Ala-His) box polypeptide 9 (DEAH (Asp-Glu-Ala-His) box polypeptide 9, isoform CRA_b) contains a PF00035 domain.

DEAH (Asp-Glu-Ala-His) box polypeptide 9 (DEAH (Asp-Glu-Ala-His) box polypeptide 9, isoform CRA_b) is proteolytically cut by caspase-3 (C14.003) cleavage. DTPD-TTAN.