cDNA FLJ43223 fis, clone FEBRA2026984, highly similar to Tyrosyl-tRNA synthetase, cytoplasmic (EC 6.1.1.1)

UniProt : B3KWK4, P54577, UniProt ID: B3KWK4_HUMAN, SYYC_HUMAN,

cDNA FLJ43223 fis, clone FEBRA2026984, highly similar to Tyrosyl-tRNA synthetase, cytoplasmic (EC 6.1.1.1)

Homo sapiens

MGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGKPHVAYFVPMSKIA
DFLKAGCEVTILFADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKG
TDYQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVD
AQFGGIDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKED
VKKKLKKAFCEPGNVENNGVLSFIKHVLFPLKSEFVILRDEKWGGNKTYTAYVDLEKDFA
AEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLASAAYPDPSKQKPMAKGPAKNSEP
EEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLV
VVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEE
LKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ43223 fis, clone FEBRA2026984, highly similar to Tyrosyl-tRNA synthetase, cytoplasmic (EC 6.1.1.1) contains a PF01588 domain.

cDNA FLJ43223 fis, clone FEBRA2026984, highly similar to Tyrosyl-tRNA synthetase, cytoplasmic (EC 6.1.1.1) contains a PF00579 domain.

cDNA FLJ43223 fis, clone FEBRA2026984, highly similar to Tyrosyl-tRNA synthetase, cytoplasmic (EC 6.1.1.1) is proteolytically cut by neutrophil elastase (S01.131) cleavage. KNSE-PEEV.