Protein-tyrosine kinase fyn isoform a (FYN oncogene related to SRC, FGR, YES, isoform CRA_a)

UniProt : B5BU57, P06241, UniProt ID: B5BU57_HUMAN, FYN_HUMAN,

Protein-tyrosine kinase fyn isoform a (FYN oncogene related to SRC, FGR, YES, isoform CRA_a)

Homo sapiens

MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Protein-tyrosine kinase fyn isoform a (FYN oncogene related to SRC, FGR, YES, isoform CRA_a) contains a PF00018 domain.

Protein-tyrosine kinase fyn isoform a (FYN oncogene related to SRC, FGR, YES, isoform CRA_a) contains a PF07714 domain.

Protein-tyrosine kinase fyn isoform a (FYN oncogene related to SRC, FGR, YES, isoform CRA_a) contains a PF00017 domain.

Protein-tyrosine kinase fyn isoform a (FYN oncogene related to SRC, FGR, YES, isoform CRA_a) is proteolytically cut by caspase-3 (C14.003) cleavage. EERD-GSLN.