Dual specificity mitogen-activated protein kinase kinase 4

UniProt : P45985, UniProt ID: MP2K4_HUMAN,

Dual specificity mitogen-activated protein kinase kinase 4

Homo sapiens

MAAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGKRKALKLNFANPPFKSTARFT
LNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMV
HKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMEL
MSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRS
GNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYEL
ATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKE
LLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Dual specificity mitogen-activated protein kinase kinase 4 contains a PF00069 domain.

Dual specificity mitogen-activated protein kinase kinase 4 is proteolytically cut by anthrax lethal factor (M34.001) cleavage. KALK-LNFA.

Dual specificity mitogen-activated protein kinase kinase 4 is proteolytically cut by anthrax lethal factor (M34.001) cleavage. STAR-FTLN.

Dual specificity mitogen-activated protein kinase kinase 4 is proteolytically cut by anthrax lethal factor (M34.001) cleavage. KALK-LNFA.

Dual specificity mitogen-activated protein kinase kinase 4 is proteolytically cut by anthrax lethal factor (M34.001) cleavage. STAR-FTLN.

Dual specificity mitogen-activated protein kinase kinase 4 is proteolytically cut by anthrax lethal factor (M34.001) cleavage. STAR-FTLN.