Unc-5 homolog B (C. elegans) (Unc-5 homolog B (C. elegans), isoform CRA_b) (cDNA FLJ46253 fis, clone TESTI4022158, highly similar to Netrin receptor UNC5B)

UniProt : Q5T3S0, Q8IZJ1, UniProt ID: Q5T3S0_HUMAN, UNC5B_HUMAN,

Unc-5 homolog B (C. elegans) (Unc-5 homolog B (C. elegans), isoform CRA_b) (cDNA FLJ46253 fis, clone TESTI4022158, highly similar to Netrin receptor UNC5B)

Homo sapiens

MGARSGARGALLLALLLCWDPRLSQAGTDSGSEVLPDSFPSAPAEPLPYFLQEPQDAYIV
KNKPVELRCRAFPATQIYFKCNGEWVSQNDHVTQEGLDEATGLRVREVQIEVSRQQVEEL
FGLEDYWCQCVAWSSAGTTKSRRAYVRIAYLRKNFDQEPLGKEVPLDHEVLLQCRPPEGV
PVAEVEWLKNEDVIDPTQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTAT
VIVYVNGGWSSWAEWSPCSNRCGRGWQKRTRTCTNPAPLNGGAFCEGQAFQKTACTTICP
VDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCMQNKKTL
SDPNSHLLEASGDAALYAGLVVAIFVVVAILMAVGVVVYRRNCRDFDTDITDSSAALTGG
FHPVNFKTARPSNPQLLHPSVPPDLTASAGIYRGPVYALQDSTDKIPMTNSPLLDPLPSL
KVKVYSSSTTGSGPGLADGADLLGVLPPGTYPSDFARDTHFLHLRSASLGSQQLLGLPRD
PGSSVSGTFGCLGGRLSIPGTGVSLLVPNGAIPQGKFYEMYLLINKAESTLPLSEGTQTV
LSPSVTCGPTGLLLCRPVILTMPHCAEVSARDWIFQLKTQAHQGHWEEVVTLDEETLNTP
CYCQLEPRACHILLDQLGTYVFTGESYSRSAVKRLQLAVFAPALCTSLEYSLRVYCLEDT
PVALKEVLELERTLGGYLVEEPKPLMFKDSYHNLRLSLHDLPHAHWRSKLLAKYQEIPFY
HIWSGSQKALHCTFTLERHSLASTELTCKICVRQVEGEGQIFQLHTTLAETPAGSLDTLC
SAPGSTVTTQLGPYAFKIPLSIRQKICNSLDAPNSRGNDWRMLAQKLSMDRYLNYFATKA
SPTGVILDLWEALQQDDGDLNSLASALEEMGKSEMLVAVATDGDC

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Unc-5 homolog B (C. elegans) (Unc-5 homolog B (C. elegans), isoform CRA_b) (cDNA FLJ46253 fis, clone TESTI4022158, highly similar to Netrin receptor UNC5B) contains a PF00090 domain.

Unc-5 homolog B (C. elegans) (Unc-5 homolog B (C. elegans), isoform CRA_b) (cDNA FLJ46253 fis, clone TESTI4022158, highly similar to Netrin receptor UNC5B) contains a PF00090 domain.

Unc-5 homolog B (C. elegans) (Unc-5 homolog B (C. elegans), isoform CRA_b) (cDNA FLJ46253 fis, clone TESTI4022158, highly similar to Netrin receptor UNC5B) contains a PF00531 domain.

Unc-5 homolog B (C. elegans) (Unc-5 homolog B (C. elegans), isoform CRA_b) (cDNA FLJ46253 fis, clone TESTI4022158, highly similar to Netrin receptor UNC5B) contains a PF00791 domain.

Unc-5 homolog B (C. elegans) (Unc-5 homolog B (C. elegans), isoform CRA_b) (cDNA FLJ46253 fis, clone TESTI4022158, highly similar to Netrin receptor UNC5B) contains a PF07679 domain.

Unc-5 homolog B (C. elegans) (Unc-5 homolog B (C. elegans), isoform CRA_b) (cDNA FLJ46253 fis, clone TESTI4022158, highly similar to Netrin receptor UNC5B) is proteolytically cut by caspase-3 (C14.003) cleavage. DITD-SSAA.