cDNA FLJ77287, highly similar to Homo sapiens caspase 2, apoptosis-related cysteine peptidase (neural cell expressed, developmentally down-regulated 2) (CASP2), transcript variant 1, mRNA (HCG20684, isoform CRA_c)

UniProt : A8K5F9, P42575, UniProt ID: A8K5F9_HUMAN, CASP2_HUMAN,

cDNA FLJ77287, highly similar to Homo sapiens caspase 2, apoptosis-related cysteine peptidase (neural cell expressed, developmentally down-regulated 2) (CASP2), transcript variant 1, mRNA (HCG20684, isoform CRA_c)

Homo sapiens

MAAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHL
LEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLT
TLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPVCLQVKPCT
PEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDV
HVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLF
DNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGKEKLPKMRLPT
RSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGY
APGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ77287, highly similar to Homo sapiens caspase 2, apoptosis-related cysteine peptidase (neural cell expressed, developmentally down-regulated 2) (CASP2), transcript variant 1, mRNA (HCG20684, isoform CRA_c) contains a PF00619 domain.

cDNA FLJ77287, highly similar to Homo sapiens caspase 2, apoptosis-related cysteine peptidase (neural cell expressed, developmentally down-regulated 2) (CASP2), transcript variant 1, mRNA (HCG20684, isoform CRA_c) contains a PF00656 domain.

cDNA FLJ77287, highly similar to Homo sapiens caspase 2, apoptosis-related cysteine peptidase (neural cell expressed, developmentally down-regulated 2) (CASP2), transcript variant 1, mRNA (HCG20684, isoform CRA_c) is proteolytically cut by caspase-2 (C14.006) cleavage. DNKD-GPVC.

cDNA FLJ77287, highly similar to Homo sapiens caspase 2, apoptosis-related cysteine peptidase (neural cell expressed, developmentally down-regulated 2) (CASP2), transcript variant 1, mRNA (HCG20684, isoform CRA_c) is proteolytically cut by caspase-3 (C14.003) cleavage. EESD-AGKE.