cDNA, FLJ95943, Homo sapiens arylsulfatase A (ARSA), mRNA

UniProt : B2RCA6, P15289, UniProt ID: ARSA_HUMAN, B2RCA6_HUMAN,

cDNA, FLJ95943, Homo sapiens arylsulfatase A (ARSA), mRNA

Homo sapiens

MGAPRSLLLALAAGLAVARPPNIVLIFADDLGYGDLGCYGHPSSTTPNLDQLAAGGLRFT
DFYVPVSLCTPSRAALLTGRLPVRMGMYPGVLVPSSRGGLPLEEVTVAEVLAARGYLTGM
AGKWHLGVGPEGAFLPPHQGFHRFLGIPYSHDQGPCQNLTCFPPATPCDGGCDQGLVPIP
LLANLSVEAQPPWLPGLEARYMAFAHDLMADAQRQDRPFFLYYASHHTHYPQFSGQSFAE
RSGRGPFGDSLMELDAAVGTLMTAIGDLGLLEETLVIFTADNGPETMRMSRGGCSGLLRC
GKGTTYEGGVREPALAFWPGHIAPGVTHELASSLDLLPTLAALAGAPLPNVTLDGFDLSP
LLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASSSL
TAHEPPLLYDLSKDPGENYNLLGGVAGATPEVLQALKQLQLLKAQLDAAVTFGPSQVARG
EDPALQICCHPGCTPRPACCHCPDPHA

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ95943, Homo sapiens arylsulfatase A (ARSA), mRNA contains a PF00884 domain.

cDNA, FLJ95943, Homo sapiens arylsulfatase A (ARSA), mRNA is proteolytically cut by () cleavage. LAVA-RPPN.

cDNA, FLJ95943, Homo sapiens arylsulfatase A (ARSA), mRNA is proteolytically cut by glutamyl peptidase I (S01.269) cleavage. AQLD-AAVT.

cDNA, FLJ95943, Homo sapiens arylsulfatase A (ARSA), mRNA is proteolytically cut by glutamyl peptidase I (S01.269) cleavage. TTYE-GGVR.

cDNA, FLJ95943, Homo sapiens arylsulfatase A (ARSA), mRNA is proteolytically cut by glutamyl peptidase I (S01.269) cleavage. VGPE-GAFL.

cDNA, FLJ95943, Homo sapiens arylsulfatase A (ARSA), mRNA is proteolytically cut by glutamyl peptidase I (S01.269) cleavage. GVRE-PALA.

cDNA, FLJ95943, Homo sapiens arylsulfatase A (ARSA), mRNA is proteolytically cut by glutamyl peptidase I (S01.269) cleavage. TVAE-VLAA.

cDNA, FLJ95943, Homo sapiens arylsulfatase A (ARSA), mRNA is proteolytically cut by glutamyl peptidase I (S01.269) cleavage. PGLE-ARYM.

cDNA, FLJ95943, Homo sapiens arylsulfatase A (ARSA), mRNA is proteolytically cut by () cleavage..