cDNA FLJ77581, highly similar to Homo sapiens beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a, mRNA (Beta-site APP-cleaving enzyme 2, isoform CRA_c)

UniProt : A8K7P1, Q9Y5Z0, UniProt ID: A8K7P1_HUMAN, BACE2_HUMAN,

cDNA FLJ77581, highly similar to Homo sapiens beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a, mRNA (Beta-site APP-cleaving enzyme 2, isoform CRA_c)

Homo sapiens

MGALARALLLPLLAQWLLRAAPELAPAPFTLPLRVAAATNRVVAPTPGPGTPAERHADGL
ALALEPALASPAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAG
TPHSYIDTYFDTERSSTYRSKGFDVTVKYTQGSWTGFVGEDLVTIPKGFNTSFLVNIATI
FESENFFLPGIKWNGILGLAYATLAKPSSSLETFFDSLVTQANIPNVFSMQMCGAGLPVA
GSGTNGGSLVLGGIEPSLYKGDIWYTPIKEEWYYQIEILKLEIGGQSLNLDCREYNADKA
IVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSETPWSYFPKISI
YLRDENSSRSFRITILPQLYIQPMMGAGLNYECYRFGISPSTNALVIGATVMEGFYVIFD
RAQKRVGFAASPCAEIAGAAVSEISGPFSTEDVASNCVPAQSLSEPILWIVSYALMSVCG
AILLVLIVLLLLPFRCQRRPRDPEVVNDESSLVRHRWK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ77581, highly similar to Homo sapiens beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a, mRNA (Beta-site APP-cleaving enzyme 2, isoform CRA_c) contains a PF00026 domain.

cDNA FLJ77581, highly similar to Homo sapiens beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a, mRNA (Beta-site APP-cleaving enzyme 2, isoform CRA_c) is proteolytically cut by memapsin-1 (A01.041) cleavage. GLAL-ALEP.

cDNA FLJ77581, highly similar to Homo sapiens beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a, mRNA (Beta-site APP-cleaving enzyme 2, isoform CRA_c) is proteolytically cut by memapsin-1 (A01.041) cleavage. GLAL-ALEP.