Dipeptidyl-peptidase 1

UniProt : P53634, UniProt ID: CATC_HUMAN,

Dipeptidyl-peptidase 1

Homo sapiens

MGAGPSLLLAALLLLLSGDGAVRCDTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQ
EKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVTTYCNE
TMTGWVHDVLGRNWACFTGKKVGTASENVYVNTAHLKNSQEKYSNRLYKYDHNFVKAINA
IQKSWTATTYMEYETLTLGDMIRRSGGHSRKIPRPKPAPLTAEIQQKILHLPTSWDWRNV
HGINFVSPVRNQASCGSCYSFASMGMLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEG
GFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCNEALM
KLELVHHGPMAVAFEVYDDFLHYKKGIYHHTGLRDPFNPFELTNHAVLLVGYGTDSASGM
DYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Dipeptidyl-peptidase 1 contains a PF08773 domain.

Dipeptidyl-peptidase 1 contains a PF00112 domain.

Dipeptidyl-peptidase 1 is proteolytically cut by cathepsin L (C01.032) cleavage. AVRC-DTPA.

Dipeptidyl-peptidase 1 is proteolytically cut by cathepsin L (C01.032) cleavage. AHLK-NSQE.

Dipeptidyl-peptidase 1 is proteolytically cut by cathepsin L (C01.032) cleavage. IQQK-ILHL.

Dipeptidyl-peptidase 1 is proteolytically cut by cathepsin L (C01.032) cleavage. TGLR-DPFN.