cDNA, FLJ94232, Homo sapiens nerve growth factor receptor (TNFR superfamily, member16) (NGFR), mRNA (Nerve growth factor receptor) (TNFR superfamily, member 16)

UniProt : B2R961, P08138, UniProt ID: B2R961_HUMAN, TNR16_HUMAN,

cDNA, FLJ94232, Homo sapiens nerve growth factor receptor (TNFR superfamily, member16) (NGFR), mRNA (Nerve growth factor receptor) (TNFR superfamily, member 16)

Homo sapiens

MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGAN
QTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTG
RCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLREC
TRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQ
PVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEK
LHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWR
HLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE
STATSPV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA, FLJ94232, Homo sapiens nerve growth factor receptor (TNFR superfamily, member16) (NGFR), mRNA (Nerve growth factor receptor) (TNFR superfamily, member 16) contains a PF00020 domain.

cDNA, FLJ94232, Homo sapiens nerve growth factor receptor (TNFR superfamily, member16) (NGFR), mRNA (Nerve growth factor receptor) (TNFR superfamily, member 16) contains a PF00020 domain.

cDNA, FLJ94232, Homo sapiens nerve growth factor receptor (TNFR superfamily, member16) (NGFR), mRNA (Nerve growth factor receptor) (TNFR superfamily, member 16) contains a PF00531 domain.

cDNA, FLJ94232, Homo sapiens nerve growth factor receptor (TNFR superfamily, member16) (NGFR), mRNA (Nerve growth factor receptor) (TNFR superfamily, member 16) contains a PF00020 domain.

cDNA, FLJ94232, Homo sapiens nerve growth factor receptor (TNFR superfamily, member16) (NGFR), mRNA (Nerve growth factor receptor) (TNFR superfamily, member 16) contains a PF00020 domain.

cDNA, FLJ94232, Homo sapiens nerve growth factor receptor (TNFR superfamily, member16) (NGFR), mRNA (Nerve growth factor receptor) (TNFR superfamily, member 16) is proteolytically cut by ADAM17 peptidase (M12.217) cleavage..