cDNA FLJ76327, highly similar to Homo sapiens RAD21 homolog (S. pombe) (RAD21), mRNA (RAD21 homolog (S. pombe), isoform CRA_a)

UniProt : A8K0E0, O60216, UniProt ID: A8K0E0_HUMAN, RAD21_HUMAN,

cDNA FLJ76327, highly similar to Homo sapiens RAD21 homolog (S. pombe) (RAD21), mRNA (RAD21 homolog (S. pombe), isoform CRA_a)

Homo sapiens

MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLL
LGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENREAAYNAITLPEEFHDFDQP
LPDLDDIDVAQQFSLNQSRVEEITMREEVGNISILQENDFGDFGMDDREIMREGSAFEDD
DMLVSTTTSNLLLESEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGGILDDKLISNNDGG
IFDDPPALSEAGVMLPEQPAHDDMDEDDNVSMGGPDSPDSVDPVEPMPTMTDQTTLVPNE
EEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKL
MMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEF
ENPEVPREDQQQQHQQRDVIDEPIIEEPSRLQESVMEASRTNIDESAMPPPPPQGVKRKA
GQIDPEPVMPPQQVEQMEIPPVELPPEEPPNICQLIPELELLPEKEKEKEKEKEDDEEEE
DEDASGGDQDQEERRWNKRTQQMLHGLQRALAKTGAESISLLELCRNTNRKQAAAKFYSF
LVLKKQQAIELTQEEPYSDIIATPGPRFHII

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

cDNA FLJ76327, highly similar to Homo sapiens RAD21 homolog (S. pombe) (RAD21), mRNA (RAD21 homolog (S. pombe), isoform CRA_a) contains a PF04825 domain.

cDNA FLJ76327, highly similar to Homo sapiens RAD21 homolog (S. pombe) (RAD21), mRNA (RAD21 homolog (S. pombe), isoform CRA_a) contains a PF04824 domain.

cDNA FLJ76327, highly similar to Homo sapiens RAD21 homolog (S. pombe) (RAD21), mRNA (RAD21 homolog (S. pombe), isoform CRA_a) is proteolytically cut by caspase-3 (C14.003) cleavage. DSPD-SVDP.

cDNA FLJ76327, highly similar to Homo sapiens RAD21 homolog (S. pombe) (RAD21), mRNA (RAD21 homolog (S. pombe), isoform CRA_a) is proteolytically cut by separase (C50.001) cleavage. EPSR-LQES.

cDNA FLJ76327, highly similar to Homo sapiens RAD21 homolog (S. pombe) (RAD21), mRNA (RAD21 homolog (S. pombe), isoform CRA_a) is proteolytically cut by separase (C50.001) cleavage. EIMR-EGSA.

cDNA FLJ76327, highly similar to Homo sapiens RAD21 homolog (S. pombe) (RAD21), mRNA (RAD21 homolog (S. pombe), isoform CRA_a) is proteolytically cut by caspase-3 (C14.003) cleavage. DSPD-SVDP.

cDNA FLJ76327, highly similar to Homo sapiens RAD21 homolog (S. pombe) (RAD21), mRNA (RAD21 homolog (S. pombe), isoform CRA_a) is proteolytically cut by separase (C50.001) cleavage. EPSR-LQES.

cDNA FLJ76327, highly similar to Homo sapiens RAD21 homolog (S. pombe) (RAD21), mRNA (RAD21 homolog (S. pombe), isoform CRA_a) is proteolytically cut by separase (C50.001) cleavage. EIMR-EGSA.

cDNA FLJ76327, highly similar to Homo sapiens RAD21 homolog (S. pombe) (RAD21), mRNA (RAD21 homolog (S. pombe), isoform CRA_a) is proteolytically cut by caspase-7 (C14.004) cleavage. DSPD-SVDP.

cDNA FLJ76327, highly similar to Homo sapiens RAD21 homolog (S. pombe) (RAD21), mRNA (RAD21 homolog (S. pombe), isoform CRA_a) is proteolytically cut by caspase-3 (C14.003) cleavage. DSPD-SVDP.