46 kDa FK506-binding nuclear protein

UniProt : Q26486, UniProt ID: FKBP4_SPOFR,

46 kDa FK506-binding nuclear protein

Spodoptera frugiperda

MFWGLIMEPNKRYTQVVEKPFHISQAAMDISTGDNDPCQVMVVVDGKNFLVCTLQKGKII
QVPLDLYFKSGDSVSFLTNGKCNVHLTGYLDPEFEEDLEDEEEAEEEEEEEEAPPLVPAK
NKRKLENANDATANKKAKPDKKAGKNSAPAAESDSDDDDEDQLQKFLDGEDIDTDENDES
FKMNTSAEGDDSDEEDDDEDEEDEEDDDEDDEEEEEAPKKKKKQPAAEQDSTLDTSKESV
DMSKLSKSQKRRLKKKLQQQAKQQPQVNGVDKPKKEEPQQKAEKKKPEAKKEEAPVEKKE
KKQIAGGVSIEDLKVGSGPVAKAGKVVMVYYEGRLKQNNKMFDNCVKGPGFKFRLGSKEV
ISGWDVGIAGMKVGGKRKIVCPPAMAYGAKGSPPVIPPNSTLVFEVDLKNVK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

46 kDa FK506-binding nuclear protein contains a PF00254 domain.

46 kDa FK506-binding nuclear protein is proteolytically cut by caspase (insect 1) (C14.015) cleavage..