Isoform 2 of Serine protease HTRA2, mitochondrial

UniProt : O43464, UniProt ID: O43464-2,

Isoform 2 of Serine protease HTRA2, mitochondrial

Homo sapiens

MAAPRAGRGAGWSLRAWRALGGIRWGRRPRLTPDLRALLTSGTSDPRARVTYGTPSLWAR
LSVGVTEPRACLTSGTPGPRAQLTAVTPDTRTREASENSGTRSRAWLAVALGAGGAVLLL
LWGGGRGPPAVLAAVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPIS
NGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKFGN
SGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVM
MLTLSPRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVT
E

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Isoform 2 of Serine protease HTRA2, mitochondrial contains a PF00595 domain.

Isoform 2 of Serine protease HTRA2, mitochondrial contains a PF00089 domain.

Isoform 2 of Serine protease HTRA2, mitochondrial is proteolytically cut by PARL peptidase (S54.009) cleavage..

Isoform 2 of Serine protease HTRA2, mitochondrial is proteolytically cut by PARL peptidase (S54.009) cleavage..

Isoform 2 of Serine protease HTRA2, mitochondrial is proteolytically cut by HtrA2 peptidase (S01.278) cleavage. AVLA-AVPS.