Histidine-rich glycoprotein (Fragment)

UniProt : Q28640, UniProt ID: HRG_RABIT,

Histidine-rich glycoprotein (Fragment)

Oryctolagus cuniculus

ATLQCSWALTPTDCKTTKPLAEKALDLINKWRRDGYLFQLLRVADAHLDGAESATVYYLV
LDVKETDCSVLSRKHWEDCDPDLTKRPSLDVIGQCKVIATRYSDEYQTLRLNDFNCTTSS
VSSALANTKDSPVLFDFIEDTEPFRKSADKALEVYKSESEAYASFRVDRVERVTRVKGGE
RTNYYVDFSVRNCSRSHFHRHPAFGFCRADLSFDVEASNLENPEDVIISCEVFNFEEHGN
ISGFRPHLGKTPLGTDGSRDHHHPHKPHKFGCPPPQEGEDFSEGPPLQGGTPPLSPPFRP
RCRHRPFGTNETHRFPHHRISVNIIHRPPPHGHHPHGPPPHGHHPHGPPPHGHPPHGPPP
RHPPHGPPPHGHPPHGPPPHGHPPHGPPPHGHPPHGPPPHGHPPHGHGFHDHGPCDPPSH
KEGPQDLHQHAMGPPPKHPGKRGPGKGHFPFHWRRIGSVYQLPPLQKGEVLPLPEANFPQ
LLLRNHTHPLKPEIQPFPQVASERCPEEFNGEFAQLSKFFPSTFPK

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Histidine-rich glycoprotein (Fragment) contains a PF00031 domain.

Histidine-rich glycoprotein (Fragment) is proteolytically cut by plasmin (S01.233) cleavage. PSHK-EGPQ.

Histidine-rich glycoprotein (Fragment) is proteolytically cut by plasmin (S01.233) cleavage. PRCR-HRPF.