PMAP: SubstrateDB : Isoform 2 of Fibrinogen alpha chain

Isoform 2 of Fibrinogen alpha chain

UniProt : P02671, Q4QQH7, UniProt ID: P02671-2, Q4QQH7_HUMAN,

Isoform 2 of Fibrinogen alpha chain

Homo sapiens

MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDSDWPFCSDEDW
NYKCPSGCRMKGLIDEVNQDFTNRINKLKNSLFEYQKNNKDSHSLTTNIMEILRGDFSSA
NNRDNTYNRVSEDLRSRIEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSC
RGSCSRALAREVDLKDYEDQQKQLEQVIAKDLLPSRDRQHLPLIKMKPVPDLVPGNFKSQ
LQKVPPEWKALTDMPQMRMELERPGGNEITRGGSTSYGTGSETESPRNPSSAGSWNSGSS
GPGSTGNRNPGSSGTGGTATWKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTW
NPGSSERGSAGHWTSESSVSGSTGQWHSESGSFRPDSPGSGNARPNNPDWGTFEEVSGNV
SPGTRREYHTEKLVTSKGDKELRTGKEKVTSGSTTTTRRSCSKTVTKTVIGPDGHKEVTK
EVVTSEDGSDCPEAMDLGTLSGIGTLDGFRHRHPDEAAFFDTASTGKTFPGFFSPMLGEF
VSETESRGSESGIFTNTKESSSHHPGIAEFPSRGKSSSYSKQFTSSTSYNRGDSTFESKS
YKMADEAGSEADHEGTHSTKRGHAKSRPVRGIHTSPLGKPSLSP

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range:	-
Cleavage position:
Cleavage residues:

Isoform 2 of Fibrinogen alpha chain contains a PF08702 domain.

Isoform 2 of Fibrinogen alpha chain contains a PF00147 domain.

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by gingipain K (C25.002) cleavage..

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. GDKE-LRTG.

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by kallikrein hK14 (S01.029) cleavage. DGFR-HRHP.

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by gingipain K (C25.002) cleavage..

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. GDKE-LRTG.

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by kallikrein hK14 (S01.029) cleavage. DGFR-HRHP.

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by streptopain (C10.001) cleavage..

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by hyaluronan-binding peptidase (S01.033) cleavage..

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by gingipain K (C25.002) cleavage..

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. GDKE-LRTG.

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by kallikrein hK14 (S01.029) cleavage. DGFR-HRHP.

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by streptopain (C10.001) cleavage..

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by hyaluronan-binding peptidase (S01.033) cleavage..

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by mocarhagin (M12.173) cleavage. AAFF-DTAS.

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by mocarhagin (M12.173) cleavage. HTEK-LVTS.

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. TAWT-ADSG.

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by matrix metallopeptidase-8 (M10.002) cleavage. GDKE-LRTG.

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. TAWT-ADSG.

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. MLGE-FVSE.

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by matrix metallopeptidase-12 (M10.009) cleavage. HTEK-LVTS.

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. GDKE-LRTG.

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. TAWT-ADSG.

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. DSHS-LTTN.

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. HTEK-LVTS.

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by membrane-type matrix metallopeptidase-1 (M10.014) cleavage. LRGD-FSSA.

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by plasmin (S01.233) cleavage..

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by graminelysin (M12.163) cleavage..

Isoform 2 of Fibrinogen alpha chain is proteolytically cut by kallikrein hK14 (S01.029) cleavage. RGPR-VVER.