Fibrinogen alpha chain

UniProt : P02671, UniProt ID: FIBA_HUMAN,

Fibrinogen alpha chain

Homo sapiens

MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDSDWPFCSDEDW
NYKCPSGCRMKGLIDEVNQDFTNRINKLKNSLFEYQKNNKDSHSLTTNIMEILRGDFSSA
NNRDNTYNRVSEDLRSRIEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSC
RGSCSRALAREVDLKDYEDQQKQLEQVIAKDLLPSRDRQHLPLIKMKPVPDLVPGNFKSQ
LQKVPPEWKALTDMPQMRMELERPGGNEITRGGSTSYGTGSETESPRNPSSAGSWNSGSS
GPGSTGNRNPGSSGTGGTATWKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTW
NPGSSERGSAGHWTSESSVSGSTGQWHSESGSFRPDSPGSGNARPNNPDWGTFEEVSGNV
SPGTRREYHTEKLVTSKGDKELRTGKEKVTSGSTTTTRRSCSKTVTKTVIGPDGHKEVTK
EVVTSEDGSDCPEAMDLGTLSGIGTLDGFRHRHPDEAAFFDTASTGKTFPGFFSPMLGEF
VSETESRGSESGIFTNTKESSSHHPGIAEFPSRGKSSSYSKQFTSSTSYNRGDSTFESKS
YKMADEAGSEADHEGTHSTKRGHAKSRPVRDCDDVLQTHPSGTQSGIFNIKLPGSSKIFS
VYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLNDEGEGEFWLGNDYLHLLTQR
GSVLRVELEDWAGNEAYAEYHFRVGSEAEGYALQVSSYEGTAGDALIEGSVEEGAEYTSH
NNMQFSTFDRDADQWEENCAEVYGGGWWYNNCQAANLNGIYYPGGSYDPRNNSPYEIENG
VVWVSFRGADYSLRAVRMKIRPLVTQ

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Fibrinogen alpha chain contains a PF08702 domain.

Fibrinogen alpha chain contains a PF00147 domain.

Fibrinogen alpha chain is proteolytically cut by kallikrein hK6 (S01.236) cleavage..

Fibrinogen alpha chain is proteolytically cut by gingipain K (C25.002) cleavage..

Fibrinogen alpha chain is proteolytically cut by kallikrein hK6 (S01.236) cleavage..

Fibrinogen alpha chain is proteolytically cut by gingipain K (C25.002) cleavage..

Fibrinogen alpha chain is proteolytically cut by streptopain (C10.001) cleavage..

Fibrinogen alpha chain is proteolytically cut by hyaluronan-binding peptidase (S01.033) cleavage..

Fibrinogen alpha chain is proteolytically cut by kallikrein hK6 (S01.236) cleavage..

Fibrinogen alpha chain is proteolytically cut by gingipain K (C25.002) cleavage..

Fibrinogen alpha chain is proteolytically cut by streptopain (C10.001) cleavage..

Fibrinogen alpha chain is proteolytically cut by hyaluronan-binding peptidase (S01.033) cleavage..

Fibrinogen alpha chain is proteolytically cut by tryptase beta (S01.015) cleavage. SYNR-GDST.

Fibrinogen alpha chain is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. HTEK-LVTS.

Fibrinogen alpha chain is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. DKEL-RTGK.

Fibrinogen alpha chain is proteolytically cut by thrombin (S01.217) cleavage. GGVR-GPRV.

Fibrinogen alpha chain is proteolytically cut by matriptase-2 (S01.308) cleavage..

Fibrinogen alpha chain is proteolytically cut by kallikrein hK6 (S01.236) cleavage..

Fibrinogen alpha chain is proteolytically cut by gingipain K (C25.002) cleavage..

Fibrinogen alpha chain is proteolytically cut by streptopain (C10.001) cleavage..

Fibrinogen alpha chain is proteolytically cut by hyaluronan-binding peptidase (S01.033) cleavage..

Fibrinogen alpha chain is proteolytically cut by tryptase beta (S01.015) cleavage. SYNR-GDST.

Fibrinogen alpha chain is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. HTEK-LVTS.

Fibrinogen alpha chain is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. DKEL-RTGK.

Fibrinogen alpha chain is proteolytically cut by thrombin (S01.217) cleavage. GGVR-GPRV.

Fibrinogen alpha chain is proteolytically cut by matriptase-2 (S01.308) cleavage..

Fibrinogen alpha chain is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. GDKE-LRTG.

Fibrinogen alpha chain is proteolytically cut by cell surface serine endopeptidase CspA () cleavage..

Fibrinogen alpha chain is proteolytically cut by neutral protease Npr599 () cleavage..

Fibrinogen alpha chain is proteolytically cut by inhA2 g.p. (M06.001) cleavage..

Fibrinogen alpha chain is proteolytically cut by kallikrein hK6 (S01.236) cleavage..

Fibrinogen alpha chain is proteolytically cut by gingipain K (C25.002) cleavage..

Fibrinogen alpha chain is proteolytically cut by streptopain (C10.001) cleavage..

Fibrinogen alpha chain is proteolytically cut by hyaluronan-binding peptidase (S01.033) cleavage..

Fibrinogen alpha chain is proteolytically cut by tryptase beta (S01.015) cleavage. SYNR-GDST.

Fibrinogen alpha chain is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. HTEK-LVTS.

Fibrinogen alpha chain is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. DKEL-RTGK.

Fibrinogen alpha chain is proteolytically cut by thrombin (S01.217) cleavage. GGVR-GPRV.

Fibrinogen alpha chain is proteolytically cut by matriptase-2 (S01.308) cleavage..

Fibrinogen alpha chain is proteolytically cut by matrix metallopeptidase-26 (M10.029) cleavage. GDKE-LRTG.

Fibrinogen alpha chain is proteolytically cut by cell surface serine endopeptidase CspA () cleavage..

Fibrinogen alpha chain is proteolytically cut by neutral protease Npr599 () cleavage..

Fibrinogen alpha chain is proteolytically cut by inhA2 g.p. (M06.001) cleavage..

Fibrinogen alpha chain is proteolytically cut by crotalase (S01.177) cleavage. GGVR-GPRV.

Fibrinogen alpha chain is proteolytically cut by fibrolase (M12.133) cleavage. HTEK-LVTS.

Fibrinogen alpha chain is proteolytically cut by cathepsin D (A01.009) cleavage. LGEF-VSET.

Fibrinogen alpha chain is proteolytically cut by cathepsin D (A01.009) cleavage. WGTF-EEVS.

Fibrinogen alpha chain is proteolytically cut by cathepsin D (A01.009) cleavage. GNFK-SQLQ.