Interstitial collagenase

UniProt : P21692, UniProt ID: MMP1_PIG,

Interstitial collagenase

Sus scrofa

MFSLLLLLLLLCNTGSHGFPAATSETQEQDVEIVQKYLKNYYNLNSDGVPVEKKRNSGLV
VEKLKQMQQFFGLKVTGKPDAETLNVMKQPRCGVPDVAEFVLTPGNPRWENTHLTYRIEN
YTPDLSREDVDRAIEKAFQLWSNVSPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN
LAHAFQPGPGIGGDAHFDEDERWTKNFRDYNLYRVAAHELGHSLGLSHSTDIGALMYPNY
IYTGDVQLSQDDIDGIQAIYGPSENPVQPSGPQTPQVCDSKLTFDAITTLRGELMFFKDR
FYMRTNSFYPEVELNFISVFWPQVPNGLQAAYEIADRDEVRFFKGNKYWAVRGQDVLYGY
PKDIHRSFGFPSTVKNIDAAVFEEDTGKTYFFVAHECWRYDEYKQSMDTGYPKMIAEEFP
GIGNKVDAVFQKDGFLYFFHGTRQYQFDFKTKRILTLQKANSWFNCRKN

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Interstitial collagenase contains a PF00045 domain.

Interstitial collagenase contains a PF01471 domain.

Interstitial collagenase contains a PF00413 domain.

Interstitial collagenase contains a PF00045 domain.

Interstitial collagenase contains a PF00045 domain.

Interstitial collagenase contains a PF00045 domain.

Interstitial collagenase is proteolytically cut by matrix metallopeptidase-1 (M10.001) cleavage. GIQA-IYGP.