NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial

UniProt : P19234, UniProt ID: NDUV2_RAT,

NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial

Rattus norvegicus

MFSLALRARASGLTAQWGRHARNLHKTAVQNGAGGALFVHRDTPENNPDTPFDFTPENYE
RIEAIVRNYPEGHRAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTM
YNRKPVGKYHIQVCTTTPCMLRDSDSILETLQRKLGIKVGETTPDKLFTLIEVECLGACV
NAPMVQINDDYYEDLTPKDIEEIIDELRAGKVPKPGPRSGRFCCEPAGGLTSLTEPPKGP
GFGVQAGL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial contains a PF01257 domain.

NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial is proteolytically cut by calpain-10 (C02.018) cleavage..