Collagen alpha-1(I) chain

UniProt : P11087, UniProt ID: CO1A1_MOUSE,

Collagen alpha-1(I) chain

Mus musculus

MFSFVDLRLLLLLGATALLTHGQEDIPEVSCIHNGLRVPNGETWKPEVCLICICHNGTAV
CDDVQCNEELDCPNPQRREGECCAFCPEEYVSPNSEDVGVEGPKGDPGPQGPRGPVGPPG
RDGIPGQPGLPGPPGPPGPPGPPGLGGNFASQMSYGYDEKSAGVSVPGPMGPSGPRGLPG
PPGAPGPQGFQGPPGEPGEPGGSGPMGPRGPPGPPGKNGDDGEAGKPGRPGERGPPGPQG
ARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQMGPRGLPGERG
RPGPPGTAGARGNDGAVGAAGPPGPTGPTGPPGFPGAVGAKGEAGPQGARGSEGPQGVRG
EPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGPQGPSGPPGPKG
NSGEPGAPGNKGDTGAKGEPGATGVQGPPGPAGEEGKRGARGEPGPSGLPGPPGERGGPG
SRGFPGADGVAGPKGPSGERGAPGPAGPKGSPGEAGRPGEAGLPGAKGLTGSPGSPGPDG
KTGPPGPAGQDGRPGPAGPPGARGQAGVMGFPGPKGTAGEPGKAGERGLPGPPGAVGPAG
KDGEAGAQGAPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGEQGVPGDLGAPG
PSGARGERGFPGERGVQGPPGPAGPRGNNGAPGNDGAKGDTGAPGAPGSQGAPGLQGMPG
ERGAAGLPGPKGDRGDAGPKGADGSPGKDGARGLTGPIGPPGPAGAPGDKGEAGPSGPPG
PTGARGAPGDRGEAGPPGPAGFAGPPGADGQPGAKGEPGDTGVKGDAGPPGPAGPAGPPG
PIGNVGAPGPKGPRGAAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGPVGKEGGKGPRG
ETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGSPGTPGPQGIAGQRGVVGLPGQRGERG
FPGLPGPSGEPGKQGPSGSSGERGPPGPMGPPGLAGPPGESGREGSPGAEGSPGRDGAPG
AKGDRGETGPAGPPGAPGAPGAPGPVGPAGKNGDRGETGPAGPAGPIGPAGARGPAGPQG
PRGDKGETGEQGDRGIKGHRGFSGLQGPPGSPGSPGEQGPSGASGPAGPRGPPGSAGSPG
KDGLNGLPGPIGPPGPRGRTGDSGPAGPPGPPGPPGPPGPPSGGYDFSFLPQPPQEKSQD
GGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMCHSDWKS
GEYWIDPNQGCNLDAIKVYCNMETGQTCVFPTQPSVPQKNWYISPNPKEKKHVWFGESMT
DGFPFEYGSEGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLKKALLLQ
GSNEIELRGEGNSRFTYSTLVDGCTSHTGTWGKTVIEYKTTKTSRLPIIDVAPLDIGAPD
QEFGLDIGPACFV

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Collagen alpha-1(I) chain contains a PF01410 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF00093 domain.

Collagen alpha-1(I) chain is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. KSAG-VSVP.

Collagen alpha-1(I) chain is proteolytically cut by matrix metallopeptidase-13 (M10.013) cleavage. KSAG-VSVP.

Collagen alpha-1(I) chain is proteolytically cut by kallikrein hK14 (S01.029) cleavage..