Serine protease HTRA2, mitochondrial

UniProt : O43464, UniProt ID: HTRA2_HUMAN,

Serine protease HTRA2, mitochondrial

Homo sapiens

MAAPRAGRGAGWSLRAWRALGGIRWGRRPRLTPDLRALLTSGTSDPRARVTYGTPSLWAR
LSVGVTEPRACLTSGTPGPRAQLTAVTPDTRTREASENSGTRSRAWLAVALGAGGAVLLL
LWGGGRGPPAVLAAVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPIS
NGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPL
PTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAA
IDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRR
YIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQM
VQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Serine protease HTRA2, mitochondrial contains a PF00595 domain.

Serine protease HTRA2, mitochondrial contains a PF00089 domain.

Serine protease HTRA2, mitochondrial is proteolytically cut by PARL peptidase (S54.009) cleavage..

Serine protease HTRA2, mitochondrial is proteolytically cut by PARL peptidase (S54.009) cleavage..

Serine protease HTRA2, mitochondrial is proteolytically cut by HtrA2 peptidase (S01.278) cleavage. AVLA-AVPS.