Collagen alpha-1(I) chain

UniProt : P02452, UniProt ID: CO1A1_HUMAN,

Collagen alpha-1(I) chain

Homo sapiens

MFSFVDLRLLLLLAATALLTHGQEEGQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRI
CVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPR
GPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPQLSYGYDEKSTGGISVPGP
MGPSGPRGLPGPPGAPGPQGFQGPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGR
PGERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQ
MGPRGLPGERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEAGPQGP
RGSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGP
QGPGGPPGPKGNSGEPGAPGSKGDTGAKGEPGPVGVQGPPGPAGEEGKRGARGEPGPTGL
PGPPGERGGPGSRGFPGADGVAGPKGPAGERGSPGPAGPKGSPGEAGRPGEAGLPGAKGL
TGSPGSPGPDGKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPGKAGERGV
PGPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGE
QGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGANGAPGNDGAKGDAGAPGAPGS
QGAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGSPGKDGVRGLTGPIGPPGPAGAPGD
KGESGPSGPAGPTGARGAPGDRGEPGPPGPAGFAGPPGADGQPGAKGEPGDAGAKGDAGP
PGPAGPAGPPGPIGNVGAPGAKGARGSAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGP
AGKEGGKGPRGETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGAPGTPGPQGIAGQRGV
VGLPGQRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGAPGA
EGSPGRDGSPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKSGDRGETGPAGPAGPVGP
VGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGP
RGPPGSAGAPGKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSAGFDFSF
LPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCR
DLKMCHSDWKSGEYWIDPNQGCNLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKD
KRHVWFGESMTDGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQ
TGNLKKALLLQGSNEIEIRAEGNSRFTYSVTVDGCTSHTGAWGKTVIEYKTTKTSRLPII
DVAPLDVGAPDQEFGFDVGPVCFL

The graphic displays domains and Protease cut sites on the protein sequence. Drag your mouse right/left over the graphic. Use the selection boxes on the right to select which annotations to view simultaneously. Combine annotation with multiple checkmarks.

InterPro Domain:
CutDB Proteolytic Event:
Protease:
MEROPS family:
Seq range: -
Cleavage position:
Cleavage residues:

Collagen alpha-1(I) chain contains a PF00093 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01410 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain contains a PF01391 domain.

Collagen alpha-1(I) chain is proteolytically cut by kallikrein hK13 (S01.306) cleavage..

Collagen alpha-1(I) chain is proteolytically cut by fibroblast activation protein alpha subunit (S09.007) cleavage..

Collagen alpha-1(I) chain is proteolytically cut by kallikrein hK13 (S01.306) cleavage..

Collagen alpha-1(I) chain is proteolytically cut by fibroblast activation protein alpha subunit (S09.007) cleavage..

Collagen alpha-1(I) chain is proteolytically cut by inhA g.p. (M06.001) cleavage..

Collagen alpha-1(I) chain is proteolytically cut by neutral protease Npr599 () cleavage..